PDB entry 1uvx

View 1uvx on RCSB PDB site
Description: heme-ligand tunneling on group I truncated hemoglobins
Class: oxygen storage/transport
Keywords: ligand diffusion, oxygen storage/transport
Deposited on 2004-01-27, released 2004-03-18
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.45 Å
R-factor: 0.216
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: globin li637
    Species: CHLAMYDOMONAS MOEWUSII [TaxId:3054]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1uvxa_
  • Heterogens: HEM, CYN, XE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1uvxA (A:)
    slfaklggreaveaavdkfynkivadptvstyfsntdmkvqrskqfaflayalggasewk
    gkdmrtahkdlvphlsdvhfqavarhlsdtltelgvppeditdamavvastrtevlnmpq
    q