PDB entry 1uvw

View 1uvw on RCSB PDB site
Description: Bacillus subtilis CotA laccase adduct with ABTS
Class: sporulation
Keywords: laccase, bacillus subtilis, multicopper oxidase, sporulation
Deposited on 2004-01-24, released 2004-05-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-12-19, with a file datestamp of 2012-12-14.
Experiment type: XRAY
Resolution: 2.45 Å
R-factor: 0.115
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: spore coat protein a
    Species: Bacillus subtilis [TaxId:1423]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1uvwa4, d1uvwa5, d1uvwa6
  • Heterogens: CU1, OXY, EBS, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1uvwA (A:)
    mtlekfvdalpipdtlkpvqqskektyyevtmeecthqlhrdlpptrlwgynglfpgpti
    evkrnenvyvkwmnnlpsthflpidhtihhsdsqheepevktvvhlhggvtpddsdgype
    awfskdfeqtgpyfkrevyhypnqqrgailwyhdhamaltrlnvyaglvgayiihdpkek
    rlklpsdeydvpllitdrtinedgslfypsapenpspslpnpsivpafcgetilvngkvw
    pyleveprkyrfrvinasntrtynlsldnggdfiqigsdggllprsvklnsfslapaery
    diiidftayegesiilansagcggdvnpetdanimqfrvtkplaqkdesrkpkylasyps
    vqheriqnirtlklagtqdeygrpvlllnnkrwhdpvtetpkvgtteiwsiinptrgthp
    ihlhlvsfrvldrrpfdiaryqesgelsytgpavppppsekgwkdtiqahagevlriaat
    fgpysgryvwhchilehedydmmrpmditdphk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uvwA (A:)
    tlekfvdalpipdtlkpvqqskektyyevtmeecthqlhrdlpptrlwgynglfpgptie
    vkrnenvyvkwmnnlpsthflpidhtihepevktvvhlhggvtpddsdgypeawfskdfe
    qtgpyfkrevyhypnqqrgailwyhdhamaltrlnvyaglvgayiihdpkekrlklpsde
    ydvpllitdrtinedgslfypsapenpspslpnpsivpafcgetilvngkvwpylevepr
    kyrfrvinasntrtynlsldnggdfiqigsdggllprsvklnsfslapaerydiiidfta
    yegesiilansagcggdvnpetdanimqfrvtkplaqkdesrkpkylasypsvqheriqn
    irtlklagtqdeygrpvlllnnkrwhdpvtetpkvgtteiwsiinptrgthpihlhlvsf
    rvldrrpfdiaryqesgelsytgpavppppsekgwkdtiqahagevlriaatfgpysgry
    vwhchilehedydmmrpmditdp