PDB entry 1uvv

View 1uvv on RCSB PDB site
Description: acetylglutamate kinase from thermotoga maritima complexed with its inhibitor arginine
Class: transferase
Keywords: n-acetyl-l-glutamate kinase, amino acid kinase, phosphoryl group transfer, arginine metabolism, transferase, arginine biosynthesis, amino-acid biosynthesis, kinase
Deposited on 2004-01-23, released 2005-05-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2005-12-13, with a file datestamp of 2007-04-25.
Experiment type: XRAY
Resolution: 2.75 Å
R-factor: 0.242
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: acetylglutamate kinase
    Species: THERMOTOGA MARITIMA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1uvva_
  • Chain 'B':
    Compound: acetylglutamate kinase
    Species: THERMOTOGA MARITIMA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1uvvb_
  • Chain 'C':
    Compound: acetylglutamate kinase
    Species: THERMOTOGA MARITIMA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1uvvc_
  • Heterogens: K, ARG, NLG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1uvvA (A:)
    mridtvnvllealpyikefygktfvikfggsamkqenakkafiqdiillkytgikpiivh
    gggpaisqmmkdlgiepvfknghrvtdektmeivemvlvgkinkeivmnlnlhggravgi
    cgkdsklivaeketkhgdigyvgkvkkvnpeilhaliendyipviapvgigedghsynin
    adtaaaeiakslmaeklilltdvdgvlkdgklistltpdeaeelirdgtvtggmipkvec
    avsavrggvgavhiingglehailleifsrkgigtmikeleg
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1uvvB (B:)
    mridtvnvllealpyikefygktfvikfggsamkqenakkafiqdiillkytgikpiivh
    gggpaisqmmkdlgiepvfknghrvtdektmeivemvlvgkinkeivmnlnlhggravgi
    cgkdsklivaeketkhgdigyvgkvkkvnpeilhaliendyipviapvgigedghsynin
    adtaaaeiakslmaeklilltdvdgvlkdgklistltpdeaeelirdgtvtggmipkvec
    avsavrggvgavhiingglehailleifsrkgigtmikeleg
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1uvvC (C:)
    mridtvnvllealpyikefygktfvikfggsamkqenakkafiqdiillkytgikpiivh
    gggpaisqmmkdlgiepvfknghrvtdektmeivemvlvgkinkeivmnlnlhggravgi
    cgkdsklivaeketkhgdigyvgkvkkvnpeilhaliendyipviapvgigedghsynin
    adtaaaeiakslmaeklilltdvdgvlkdgklistltpdeaeelirdgtvtggmipkvec
    avsavrggvgavhiingglehailleifsrkgigtmikeleg