PDB entry 1uvr

View 1uvr on RCSB PDB site
Description: structure of human pdk1 kinase domain in complex with bim-8
Deposited on 2004-01-22, released 2004-03-04
The last revision prior to the SCOP 1.71 freeze date was dated 2004-03-18, with a file datestamp of 2004-03-18.
Experiment type: XRAY
Resolution: 2.81 Å
R-factor: 0.17642
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1uvra_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1uvrA (A:)
    ppqprkkrpedfkfgkilgegsfstvvlarelatsreyaikilekrhiikenkvpyvtre
    rdvmsrldhpffvklyftfqddeklyfglsyakngellkyirkigsfdetctrfytaeiv
    saleylhgkgiihrdlkpenillnedmhiqitdfgtakvlspeskqaransfvgtaqyvs
    pellteksackssdlwalgciiyqlvaglppfragneylifqkiikleydfpekffpkar
    dlvekllvldatkrlgceemegygplkahpffesvtwenlhqqtppklt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uvrA (A:)
    ppqprkkrpedfkfgkilgegsfstvvlarelatsreyaikilekrhiikenkvpyvtre
    rdvmsrldhpffvklyftfqddeklyfglsyakngellkyirkigsfdetctrfytaeiv
    saleylhgkgiihrdlkpenillnedmhiqitdfgtakvlsparansfvgtaqyvspell
    teksackssdlwalgciiyqlvaglppfragneylifqkiikleydfpekffpkardlve
    kllvldatkrlgceemegygplkahpffesvtwenlhqqtppklt