PDB entry 1uvk

View 1uvk on RCSB PDB site
Description: The structural basis for RNA specificity and Ca2 inhibition of an RNA-dependent RNA polymerase phi6p2 dead-end complex
Class: transferase
Keywords: transferase, polymerase-complex, oligonucleotide, polymerase
Deposited on 2004-01-21, released 2004-02-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-07-12, with a file datestamp of 2017-07-07.
Experiment type: XRAY
Resolution: 2.45 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: RNA-directed RNA polymerase
    Species: PSEUDOMONAS PHAGE PHI6 [TaxId:10879]
    Gene: P2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11124 (0-663)
      • conflict (455)
    Domains in SCOPe 2.07: d1uvka_
  • Chain 'C':
    Compound: RNA-directed RNA polymerase
    Species: PSEUDOMONAS PHAGE PHI6 [TaxId:10879]
    Gene: P2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11124 (0-663)
      • conflict (455)
    Domains in SCOPe 2.07: d1uvkc_
  • Chain 'E':
    Compound: RNA-directed RNA polymerase
    Species: PSEUDOMONAS PHAGE PHI6 [TaxId:10879]
    Gene: P2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11124 (0-663)
      • conflict (455)
    Domains in SCOPe 2.07: d1uvke_
  • Heterogens: MN, MG, POP, G, GTP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1uvkA (A:)
    prrapafplsdikaqmlfannikaqqaskrsfkegaietyegllsvdprflsfknelsry
    ltdhfpanvdeygrvygngvrtnffgmrhmngfpmipatwplasnlkkradadladgpvs
    erdnllfraavrlmfsdlepvplkirkgsstcipyfsndmgtkieiaeralekaeeagnl
    mlqgkfddayqlhqmggayyvvyraqstdaitldpktgkfvskdrmvadfeyavtggeqg
    slfaaskdasrlkeqygidvpdgffcerrrtamggpfalnapimavaqpvrnkiyskyay
    tfhhttrlnkeekvkewslcvatdvsdhdtfwpgwlrdlicdellnmgyapwwvklfets
    lklpvyvgapapeqghtllgdpsnpdlevglssgqgatdlmgtllmsitylvmqldhtap
    hlnsrikdmpsacrfldsywqgheeirqisksddamlgwtkgralvgghrlfemlkegkv
    npspymkisyehggaflgdillydsrrepgsaifvgninsmlnnqfspeygvqsgvrdrs
    krkrpfpglawasmkdtygacpiysdvleaiercwwnafgesyrayredmlkrdtlelsr
    yvasmarqaglaeltpidlevladpnklqykwteadvsanihevlmhgvsvekterflrs
    vmpr
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1uvkC (C:)
    prrapafplsdikaqmlfannikaqqaskrsfkegaietyegllsvdprflsfknelsry
    ltdhfpanvdeygrvygngvrtnffgmrhmngfpmipatwplasnlkkradadladgpvs
    erdnllfraavrlmfsdlepvplkirkgsstcipyfsndmgtkieiaeralekaeeagnl
    mlqgkfddayqlhqmggayyvvyraqstdaitldpktgkfvskdrmvadfeyavtggeqg
    slfaaskdasrlkeqygidvpdgffcerrrtamggpfalnapimavaqpvrnkiyskyay
    tfhhttrlnkeekvkewslcvatdvsdhdtfwpgwlrdlicdellnmgyapwwvklfets
    lklpvyvgapapeqghtllgdpsnpdlevglssgqgatdlmgtllmsitylvmqldhtap
    hlnsrikdmpsacrfldsywqgheeirqisksddamlgwtkgralvgghrlfemlkegkv
    npspymkisyehggaflgdillydsrrepgsaifvgninsmlnnqfspeygvqsgvrdrs
    krkrpfpglawasmkdtygacpiysdvleaiercwwnafgesyrayredmlkrdtlelsr
    yvasmarqaglaeltpidlevladpnklqykwteadvsanihevlmhgvsvekterflrs
    vmpr
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1uvkE (E:)
    prrapafplsdikaqmlfannikaqqaskrsfkegaietyegllsvdprflsfknelsry
    ltdhfpanvdeygrvygngvrtnffgmrhmngfpmipatwplasnlkkradadladgpvs
    erdnllfraavrlmfsdlepvplkirkgsstcipyfsndmgtkieiaeralekaeeagnl
    mlqgkfddayqlhqmggayyvvyraqstdaitldpktgkfvskdrmvadfeyavtggeqg
    slfaaskdasrlkeqygidvpdgffcerrrtamggpfalnapimavaqpvrnkiyskyay
    tfhhttrlnkeekvkewslcvatdvsdhdtfwpgwlrdlicdellnmgyapwwvklfets
    lklpvyvgapapeqghtllgdpsnpdlevglssgqgatdlmgtllmsitylvmqldhtap
    hlnsrikdmpsacrfldsywqgheeirqisksddamlgwtkgralvgghrlfemlkegkv
    npspymkisyehggaflgdillydsrrepgsaifvgninsmlnnqfspeygvqsgvrdrs
    krkrpfpglawasmkdtygacpiysdvleaiercwwnafgesyrayredmlkrdtlelsr
    yvasmarqaglaeltpidlevladpnklqykwteadvsanihevlmhgvsvekterflrs
    vmpr