PDB entry 1uvg

View 1uvg on RCSB PDB site
Description: solution structure of the 15th domain of lekti
Deposited on 2004-01-20, released 2005-04-14
The last revision was dated 2019-10-30, with a file datestamp of 2019-10-25.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: serine proteinase inhibitor kazal type 5
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1UVG
    • Uniprot Q9NQ38 (2-77)

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >1uvgA (A:)
    gpdsemckdyrvlprigylcpkdlkpvcgddgqtynnpcmlchenlirqtnthirstgkc
    eesstpgttaasmppsde
    

    Sequence, based on observed residues (ATOM records):
    >1uvgA (A:)
    dsemckdyrvlprigylcpkdlkpvcgddgqtynnpcmlchenlirqtnthirstgkcee
    sstpgttaasmppsde