PDB entry 1uvd

View 1uvd on RCSB PDB site
Description: arginine feed-back inhibitable acetylglutamate kinase
Class: transferase
Keywords: acetylglutamate kinase, arginine inhibition, allosteric mechanism, feedback control, amino acid kinase family
Deposited on 2004-01-19, released 2005-04-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2005-12-13, with a file datestamp of 2007-04-25.
Experiment type: XRAY
Resolution: 2.95 Å
R-factor: 0.246
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: acetylglutamate kinase
    Species: PSEUDOMONAS AERUGINOSA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1uvda_
  • Chain 'B':
    Compound: acetylglutamate kinase
    Species: PSEUDOMONAS AERUGINOSA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1uvdb_
  • Chain 'C':
    Compound: acetylglutamate kinase
    Species: PSEUDOMONAS AERUGINOSA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1uvdc_
  • Chain 'D':
    Compound: acetylglutamate kinase
    Species: PSEUDOMONAS AERUGINOSA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1uvdd_
  • Chain 'E':
    Compound: acetylglutamate kinase
    Species: PSEUDOMONAS AERUGINOSA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1uvde_
  • Chain 'F':
    Compound: acetylglutamate kinase
    Species: PSEUDOMONAS AERUGINOSA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1uvdf_
  • Chain 'G':
    Compound: acetylglutamate kinase
    Species: PSEUDOMONAS AERUGINOSA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1uvdg_
  • Chain 'H':
    Compound: acetylglutamate kinase
    Species: PSEUDOMONAS AERUGINOSA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1uvdh_
  • Chain 'I':
    Compound: acetylglutamate kinase
    Species: PSEUDOMONAS AERUGINOSA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1uvdi_
  • Chain 'J':
    Compound: acetylglutamate kinase
    Species: PSEUDOMONAS AERUGINOSA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1uvdj_
  • Chain 'K':
    Compound: acetylglutamate kinase
    Species: PSEUDOMONAS AERUGINOSA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1uvdk_
  • Chain 'L':
    Compound: acetylglutamate kinase
    Species: PSEUDOMONAS AERUGINOSA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1uvdl_
  • Heterogens: MG, CL, NLG, ADP

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1uvdA (A:)
    tlsrddaaqvakvlsealpyirrfvgktlvikyggnameseelkagfardvvlmkavgin
    pvvvhgggpqigdllkrlsieshfidgmrvtdaatmdvvemvlggqvnkdivnlinrhgg
    saigltgkdaelirakkltvtrqtpemtkpeiidighvgevtgvnvgllnmlvkgdfipv
    iapigvgsngesyninadlvagkvaealkaeklmlltniaglmdkqgqvltglsteqvne
    liadgtiyggmlpkircaleavqggvtsahiidgrvpnavlleiftdsgvgtlisnrkrh
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1uvdB (B:)
    tlsrddaaqvakvlsealpyirrfvgktlvikyggnameseelkagfardvvlmkavgin
    pvvvhgggpqigdllkrlsieshfidgmrvtdaatmdvvemvlggqvnkdivnlinrhgg
    saigltgkdaelirakkltvtrqtpemtkpeiidighvgevtgvnvgllnmlvkgdfipv
    iapigvgsngesyninadlvagkvaealkaeklmlltniaglmdkqgqvltglsteqvne
    liadgtiyggmlpkircaleavqggvtsahiidgrvpnavlleiftdsgvgtlisnrkrh
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1uvdC (C:)
    tlsrddaaqvakvlsealpyirrfvgktlvikyggnameseelkagfardvvlmkavgin
    pvvvhgggpqigdllkrlsieshfidgmrvtdaatmdvvemvlggqvnkdivnlinrhgg
    saigltgkdaelirakkltvtrqtpemtkpeiidighvgevtgvnvgllnmlvkgdfipv
    iapigvgsngesyninadlvagkvaealkaeklmlltniaglmdkqgqvltglsteqvne
    liadgtiyggmlpkircaleavqggvtsahiidgrvpnavlleiftdsgvgtlisnrkrh
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1uvdD (D:)
    tlsrddaaqvakvlsealpyirrfvgktlvikyggnameseelkagfardvvlmkavgin
    pvvvhgggpqigdllkrlsieshfidgmrvtdaatmdvvemvlggqvnkdivnlinrhgg
    saigltgkdaelirakkltvtrqtpemtkpeiidighvgevtgvnvgllnmlvkgdfipv
    iapigvgsngesyninadlvagkvaealkaeklmlltniaglmdkqgqvltglsteqvne
    liadgtiyggmlpkircaleavqggvtsahiidgrvpnavlleiftdsgvgtlisnrkrh
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1uvdE (E:)
    tlsrddaaqvakvlsealpyirrfvgktlvikyggnameseelkagfardvvlmkavgin
    pvvvhgggpqigdllkrlsieshfidgmrvtdaatmdvvemvlggqvnkdivnlinrhgg
    saigltgkdaelirakkltvtrqtpemtkpeiidighvgevtgvnvgllnmlvkgdfipv
    iapigvgsngesyninadlvagkvaealkaeklmlltniaglmdkqgqvltglsteqvne
    liadgtiyggmlpkircaleavqggvtsahiidgrvpnavlleiftdsgvgtlisnrkrh
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1uvdF (F:)
    tlsrddaaqvakvlsealpyirrfvgktlvikyggnameseelkagfardvvlmkavgin
    pvvvhgggpqigdllkrlsieshfidgmrvtdaatmdvvemvlggqvnkdivnlinrhgg
    saigltgkdaelirakkltvtrqtpemtkpeiidighvgevtgvnvgllnmlvkgdfipv
    iapigvgsngesyninadlvagkvaealkaeklmlltniaglmdkqgqvltglsteqvne
    liadgtiyggmlpkircaleavqggvtsahiidgrvpnavlleiftdsgvgtlisnrkrh
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1uvdG (G:)
    tlsrddaaqvakvlsealpyirrfvgktlvikyggnameseelkagfardvvlmkavgin
    pvvvhgggpqigdllkrlsieshfidgmrvtdaatmdvvemvlggqvnkdivnlinrhgg
    saigltgkdaelirakkltvtrqtpemtkpeiidighvgevtgvnvgllnmlvkgdfipv
    iapigvgsngesyninadlvagkvaealkaeklmlltniaglmdkqgqvltglsteqvne
    liadgtiyggmlpkircaleavqggvtsahiidgrvpnavlleiftdsgvgtlisnrkrh
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1uvdH (H:)
    tlsrddaaqvakvlsealpyirrfvgktlvikyggnameseelkagfardvvlmkavgin
    pvvvhgggpqigdllkrlsieshfidgmrvtdaatmdvvemvlggqvnkdivnlinrhgg
    saigltgkdaelirakkltvtrqtpemtkpeiidighvgevtgvnvgllnmlvkgdfipv
    iapigvgsngesyninadlvagkvaealkaeklmlltniaglmdkqgqvltglsteqvne
    liadgtiyggmlpkircaleavqggvtsahiidgrvpnavlleiftdsgvgtlisnrkrh
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1uvdI (I:)
    tlsrddaaqvakvlsealpyirrfvgktlvikyggnameseelkagfardvvlmkavgin
    pvvvhgggpqigdllkrlsieshfidgmrvtdaatmdvvemvlggqvnkdivnlinrhgg
    saigltgkdaelirakkltvtrqtpemtkpeiidighvgevtgvnvgllnmlvkgdfipv
    iapigvgsngesyninadlvagkvaealkaeklmlltniaglmdkqgqvltglsteqvne
    liadgtiyggmlpkircaleavqggvtsahiidgrvpnavlleiftdsgvgtlisnrkrh
    

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1uvdJ (J:)
    tlsrddaaqvakvlsealpyirrfvgktlvikyggnameseelkagfardvvlmkavgin
    pvvvhgggpqigdllkrlsieshfidgmrvtdaatmdvvemvlggqvnkdivnlinrhgg
    saigltgkdaelirakkltvtrqtpemtkpeiidighvgevtgvnvgllnmlvkgdfipv
    iapigvgsngesyninadlvagkvaealkaeklmlltniaglmdkqgqvltglsteqvne
    liadgtiyggmlpkircaleavqggvtsahiidgrvpnavlleiftdsgvgtlisnrkrh
    

  • Chain 'K':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1uvdK (K:)
    tlsrddaaqvakvlsealpyirrfvgktlvikyggnameseelkagfardvvlmkavgin
    pvvvhgggpqigdllkrlsieshfidgmrvtdaatmdvvemvlggqvnkdivnlinrhgg
    saigltgkdaelirakkltvtrqtpemtkpeiidighvgevtgvnvgllnmlvkgdfipv
    iapigvgsngesyninadlvagkvaealkaeklmlltniaglmdkqgqvltglsteqvne
    liadgtiyggmlpkircaleavqggvtsahiidgrvpnavlleiftdsgvgtlisnrkrh
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1uvdL (L:)
    tlsrddaaqvakvlsealpyirrfvgktlvikyggnameseelkagfardvvlmkavgin
    pvvvhgggpqigdllkrlsieshfidgmrvtdaatmdvvemvlggqvnkdivnlinrhgg
    saigltgkdaelirakkltvtrqtpemtkpeiidighvgevtgvnvgllnmlvkgdfipv
    iapigvgsngesyninadlvagkvaealkaeklmlltniaglmdkqgqvltglsteqvne
    liadgtiyggmlpkircaleavqggvtsahiidgrvpnavlleiftdsgvgtlisnrkrh