PDB entry 1uvc

View 1uvc on RCSB PDB site
Description: lipid binding in rice nonspecific lipid transfer protein-1 complexes from oryza sativa
Class: lipid transport
Keywords: lipid transport, ltp 1, pap 1, rice, fatty acid binding
Deposited on 2004-01-19, released 2004-10-19
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.216
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: nonspecific lipid transfer protein
    Species: Oryza sativa [TaxId:4530]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P23096 (0-90)
      • conflict (34)
    Domains in SCOPe 2.08: d1uvca_
  • Chain 'B':
    Compound: nonspecific lipid transfer protein
    Species: Oryza sativa [TaxId:4530]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P23096 (0-90)
      • conflict (34)
    Domains in SCOPe 2.08: d1uvcb_
  • Heterogens: STE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1uvcA (A:)
    itcgqvnsavgpcltyarggagpsaaccsgvrslkaaasttadrrtacnclknaargikg
    lnagnaasipskcgvsvpytisasidcsrvs
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1uvcB (B:)
    itcgqvnsavgpcltyarggagpsaaccsgvrslkaaasttadrrtacnclknaargikg
    lnagnaasipskcgvsvpytisasidcsrvs