PDB entry 1uvb

View 1uvb on RCSB PDB site
Description: Lipid Binding in Rice Nonspecific Lipid Transfer Protein-1 Complexes from Oryza sativa
Class: lipid transport
Keywords: lipid transport, ltp 1, pap 1, rice, fatty acid binding
Deposited on 2004-01-19, released 2004-01-19
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-05-22, with a file datestamp of 2019-05-17.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: nonspecific lipid transfer protein
  Species: Oryza sativa [TaxId:4530]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P23096 (0-90)
    • conflict (34)
  Domains in SCOPe 2.08: d1uvba_
• Heterogens: PAM, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1uvbA (A:)
  itcgqvnsavgpcltyarggagpsaaccsgvrslkaaasttadrrtacnclknaargikg
  lnagnaasipskcgvsvpytisasidcsrvs