PDB entry 1uv4

View 1uv4 on RCSB PDB site
Description: native bacillus subtilis arabinanase arb43a
Class: hydrolase
Keywords: hydrolase, propeller, catalysis
Deposited on 2004-01-14, released 2005-02-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-31.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.169
AEROSPACI score: 0.64 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: arabinan-endo 1,5-alpha-l-arabinase
    Species: Bacillus subtilis [TaxId:1423]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P94522 (Start-276)
    • PDB 1UV4 (277-292)
    Domains in SCOPe 2.07: d1uv4a1
  • Heterogens: CA, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1uv4A (A:)
    eaafwgasnellhdptmikegsswyalgtglteerglrvlkssdaknwtvqksifttpls
    wwsnyvpnygqnqwapdiqyyngkywlyysvssfgsntsaiglasstsissggwkdeglv
    irstssnnynaidpeltfdkdgnpwlafgsfwsgikltkldkstmkptgslysiaarpnn
    ggaleaptltyqngyyylmvsfdkccdgvnstykiaygrsksitgpyldksgksmleggg
    tildsgndqwkgpggqdivngnilvrhaydandngipkllindlnwssgwpsy
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uv4A (A:)
    afwgasnellhdptmikegsswyalgtglteerglrvlkssdaknwtvqksifttplsww
    snyvpnygqnqwapdiqyyngkywlyysvssfgsntsaiglasstsissggwkdeglvir
    stssnnynaidpeltfdkdgnpwlafgsfwsgikltkldkstmkptgslysiaarpnngg
    aleaptltyqngyyylmvsfdkccdgvnstykiaygrsksitgpyldksgksmlegggti
    ldsgndqwkgpggqdivngnilvrhaydandngipkllindlnwssgwpsy