PDB entry 1uv0

View 1uv0 on RCSB PDB site
Description: Pancreatitis-associated protein 1 from human
Class: sugar binding protein
Keywords: lectin, c-type, secreted, inflammatory response, acute phase, sugar binding protein
Deposited on 2004-01-12, released 2004-01-14
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-10-09, with a file datestamp of 2019-10-04.
Experiment type: XRAY
Resolution: 1.78 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pancreatitis-associated protein 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1uv0a_
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1uv0A (A:)
    eepqrelpsarircpkgskaygshcyalflspkswtdadlacqkrpsgnlvsvlsgaegs
    fvsslvksignsysyvwiglhdptqgtepngegwewsssdvmnyfawernpstisspghc
    aslsrstaflrwkdyncnvrlpyvckftd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uv0A (A:)
    arircpkgskaygshcyalflspkswtdadlacqkrpsgnlvsvlsgaegsfvsslvksi
    gnsysyvwiglhdptqgtegegwewsssdvmnyfawernpstisspghcaslsrstaflr
    wkdyncnvrlpyvckftd