PDB entry 1uuy

View 1uuy on RCSB PDB site
Description: structure of a molybdopterin-bound cnx1g domain links molybdenum and copper metabolism
Class: chelatase
Keywords: chelatase, molybdenum cofactor biosynthesis
Deposited on 2004-01-12, released 2004-08-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-31.
Experiment type: XRAY
Resolution: 1.45 Å
R-factor: 0.163
AEROSPACI score: 0.69 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: molybdopterin biosynthesis cnx1
    Species: Arabidopsis thaliana [TaxId:3702]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q39054 (Start-162)
      • engineered mutation (121)
    Domains in SCOPe 2.07: d1uuya_
  • Heterogens: MTE, AMP, PPI, IMD, FMT, CU1, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1uuyA (A:)
    vpgpeykvailtvsdtvsagagpdrsgpravsvvdssseklggakvvatavvpdeverik
    dilqkwsdvdemdliltlggtgftprdvtpeatkkvieretpgllfvmmqeslkitpfam
    larsaagirgstliinmpgnpnavaecmeallpalkhalkqikgdkr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uuyA (A:)
    gpeykvailtvsdtvsagagpdrsgpravsvvdssseklggakvvatavvpdeverikdi
    lqkwsdvdemdliltlggtgftprdvtpeatkkvieretpgllfvmmqeslkitpfamla
    rsaagirgstliinmpgnpnavaecmeallpalkhalkqik