PDB entry 1uus

View 1uus on RCSB PDB site
Description: structure of an activated dictyostelium stat in its dna-unbound form
Deposited on 2004-01-09, released 2004-03-26
The last revision prior to the SCOP 1.71 freeze date was dated 2004-03-26, with a file datestamp of 2004-03-26.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.198
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1uusA (A:)
    qqgnpnlsspqpildtiykllseqeqtlvqmiheqslllnrlpptldenslaplkslsqk
    qitlsgqmntemsaldatkkgmileptdlaklfalkqdlqiqfkqlsllhneiqsilnpq
    hsapkpnvalvlksqpfpvviskgkqlgenqlvvlvltgarsnfhingpvkatmicdshp
    tnknnpttplemdsqpiypatltahfplkflagtrkcsvnlkfgvnirdldnvtttvesd
    asnpfvvitnecqwegsagvllkkdafdgqleitwaqfintlqrhfliatkqdpvrpkrp
    lssydlkyiqthffgnrsiihqqdfdkfwvwfgksmqtlryqrhistlwqegiiygymgr
    qevndalqnqdpgtfiirfsernpgqfgiayigvemparikhylvqpndtaaakktfpdf
    lsehsqfvnllqwtkdtngaprflklhkdtalgsfapkrtapvpvggyeplns
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uusA (A:)
    pnlsspqpildtiykllseqeqtlvqmiheqslllnrlpptldenslaplkslsqkqitl
    sgqmntemsaldatkkgmileptdlaklfalkqdlqiqfkqlsllhneiqsilnpqhsap
    kpnvalvlksqpfpvviskgkqlgenqlvvlvltgarsnfhingpvkatmicdshpnptt
    plemdsqpiypatltahfplkflagtrkcsvnlkfgvnirdldnvtttvesdasnpfvvi
    tnecqwegsagvllkkdafdgqleitwaqfintlqrhfliatkqdpvrpkrplssydlky
    iqthffgnrsiihqqdfdkfwvwfgksmqtlryqrhistlwqegiiygymgrqevndalq
    nqdpgtfiirfsernpgqfgiayigvemparikhylvqpndtaaakktfpdflsehsqfv
    nllqwtkdtngaprflklhkdtalgsfapkrtapvpvggyeplns