PDB entry 1uus

View 1uus on RCSB PDB site
Description: Structure of an activated Dictyostelium STAT in its DNA-unbound form
Class: signal transduction
Keywords: dictyostelium, stat, sh2, signal transduction, transducer, transcription factor
Deposited on 2004-01-09, released 2004-03-26
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-10-09, with a file datestamp of 2019-10-04.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: stat protein
    Species: DICTYOSTELIUM DISCOIDEUM [TaxId:44689]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1uusa1, d1uusa2, d1uusa3
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1uusA (A:)
    qqgnpnlsspqpildtiykllseqeqtlvqmiheqslllnrlpptldenslaplkslsqk
    qitlsgqmntemsaldatkkgmileptdlaklfalkqdlqiqfkqlsllhneiqsilnpq
    hsapkpnvalvlksqpfpvviskgkqlgenqlvvlvltgarsnfhingpvkatmicdshp
    tnknnpttplemdsqpiypatltahfplkflagtrkcsvnlkfgvnirdldnvtttvesd
    asnpfvvitnecqwegsagvllkkdafdgqleitwaqfintlqrhfliatkqdpvrpkrp
    lssydlkyiqthffgnrsiihqqdfdkfwvwfgksmqtlryqrhistlwqegiiygymgr
    qevndalqnqdpgtfiirfsernpgqfgiayigvemparikhylvqpndtaaakktfpdf
    lsehsqfvnllqwtkdtngaprflklhkdtalgsfapkrtapvpvggyeplns
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uusA (A:)
    pnlsspqpildtiykllseqeqtlvqmiheqslllnrlpptldenslaplkslsqkqitl
    sgqmntemsaldatkkgmileptdlaklfalkqdlqiqfkqlsllhneiqsilnpqhsap
    kpnvalvlksqpfpvviskgkqlgenqlvvlvltgarsnfhingpvkatmicdshpnptt
    plemdsqpiypatltahfplkflagtrkcsvnlkfgvnirdldnvtttvesdasnpfvvi
    tnecqwegsagvllkkdafdgqleitwaqfintlqrhfliatkqdpvrpkrplssydlky
    iqthffgnrsiihqqdfdkfwvwfgksmqtlryqrhistlwqegiiygymgrqevndalq
    nqdpgtfiirfsernpgqfgiayigvemparikhylvqpndtaaakktfpdflsehsqfv
    nllqwtkdtngaprflklhkdtalgsfapkrtapvpvggyeplns