PDB entry 1uur

View 1uur on RCSB PDB site
Description: structure of an activated dictyostelium stat in its DNA-unbound form
Class: transcription activator
Keywords: transcription activator, dictyostelium, stat, sh2, signal transduction, transducer, transcription factor
Deposited on 2004-01-09, released 2004-03-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-06-16, with a file datestamp of 2009-06-12.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.21
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: stata protein
    Species: DICTYOSTELIUM DISCOIDEUM [TaxId:44689]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1uura1, d1uura2, d1uura3
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1uurA (A:)
    qqgnpnlsspqpildtiykllseqeqtlvqmiheqslllnrlpptldenslaplkslsqk
    qitlsgqmntemsaldatkkgmileptdlaklfalkqdlqiqfkqlsllhneiqsilnpq
    hsapkpnvalvlksqpfpvviskgkqlgenqlvvlvltgarsnfhingpvkatmicdshp
    tnknnpttplemdsqpiypatltahfplkflagtrkcsvnlkfgvnirdldnvtttvesd
    asnpfvvitnecqwegsagvllkkdafdgqleitwaqfintlqrhfliatkqdpvrpkrp
    lssydlkyiqthffgnrsiihqqdfdkfwvwfgksmqtlryqrhistlwqegiiygymgr
    qevndalqnqdpgtfiirfsernpgqfgiayigvemparikhylvqpndtaaakktfpdf
    lsehsqfvnllqwtkdtngaprflklhkdtalgsfapkrtapvpvggyeplns
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uurA (A:)
    sspqpildtiykllseqeqtlvqmiheqslllnrlpptldenslaplkslsqkqitlsgq
    mntemsaldatkkgmileptdlaklfalkqdlqiqfkqlsllhneiqsilnpqhsapkpn
    valvlksqpfpvviskgkqlgenqlvvlvltgarsnfhingpvkatmicdshppttplem
    dsqpiypatltahfplkflagtrkcsvnlkfgvnirdldnvtttvesdasnpfvvitnec
    qwegsagvllkkdafdgqleitwaqfintlqrhfliatkqdpvrpkrplssydlkyiqth
    ffgnrsiihqqdfdkfwvwfgksmqtlryqrhistlwqegiiygymgrqevndalqnqdp
    gtfiirfsernpgqfgiayigvemparikhylvqpndtaaakktfpdflsehsqfvnllq
    wtkdtngaprflklhkdtalgsfapkrtapvpvggyeplns