PDB entry 1uuq

View 1uuq on RCSB PDB site
Description: exo-mannosidase from cellvibrio mixtus
Class: hydrolase
Keywords: hydrolase, mannosidase, mannan, glycoside hydrolase, family 5
Deposited on 2004-01-09, released 2004-04-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.123
AEROSPACI score: 0.69 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: mannosyl-oligosaccharide glucosidase
    Species: CELLVIBRIO MIXTUS [TaxId:39650]
    Database cross-references and differences (RAF-indexed):
    • PDB 1UUQ
    Domains in SCOPe 2.07: d1uuqa_
  • Heterogens: GOL, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1uuqA (A:)
    mvaesnsavaptanvatspahehfvrvngghfelqgkpyvitgvnmwyaaylgapnevgd
    rdrlakeldnlkaigvnnlrvlavsekseinsavkpavtngfgnydetllqgldyllvel
    akrdmtvvlyfnnfwqwsggmtqymawiegepvqdpnvtneweafmaksasfyrsekaqq
    eyrktlekiitrvnsingkayvddatimswqlaneprpgnsqttaeekqiyidwvhaaaa
    yiktldahhlvssgsegemgsvndmqvfidahatpdidyltyhmwirnwswfdktkpaet
    wpsawekaqnymrahidvakqlnkplvleefgldrdmgsyamdstteyrdnyfrgvfelm
    lasleqgepsagyniwawngygrttranywwqegddfmgdppqeeqgmygvfdtdtstia
    imkefnarfqpklehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uuqA (A:)
    ehfvrvngghfelqgkpyvitgvnmwyaaylgapnevgdrdrlakeldnlkaigvnnlrv
    lavsekseinsavkpavtngfgnydetllqgldyllvelakrdmtvvlyfnnfwqwsggm
    tqymawiegepvqdpnvtneweafmaksasfyrsekaqqeyrktlekiitrvnsingkay
    vddatimswqlaneprpgnsqttaeekqiyidwvhaaaayiktldahhlvssgsegemgs
    vndmqvfidahatpdidyltyhmwirnwswfdktkpaetwpsawekaqnymrahidvakq
    lnkplvleefgldrdmgsyamdstteyrdnyfrgvfelmlasleqgepsagyniwawngy
    grttranywwqegddfmgdppqeeqgmygvfdtdtstiaimkefnarfqp