PDB entry 1uup

View 1uup on RCSB PDB site
Description: crystal structure of a dimeric form of streptococcal pyrogenic exotoxin a (spea1).
Class: toxin
Keywords: toxin, molecular recognition, x-ray crystallography, superantigen, exotoxin, zinc binding, dimer
Deposited on 2004-01-08, released 2004-08-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.2152
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: exotoxin type a
    Species: STREPTOCOCCUS PYOGENES [TaxId:1314]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1uupa1, d1uupa2
  • Chain 'B':
    Compound: exotoxin type a
    Species: STREPTOCOCCUS PYOGENES [TaxId:1314]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1uupb1, d1uupb2
  • Chain 'C':
    Compound: exotoxin type a
    Species: STREPTOCOCCUS PYOGENES [TaxId:1314]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1uupc1, d1uupc2
  • Chain 'D':
    Compound: exotoxin type a
    Species: STREPTOCOCCUS PYOGENES [TaxId:1314]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1uupd1, d1uupd2
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1uupA (A:)
    qqdpdpsqlhrsslvknlqniyflyegdpvthenvksvdqllshdliynvsgpnydklkt
    elknqematlfkdknvdiygveyyhlcylcenaersaciyggvtnhegnhleipkkivvk
    vsidgiqslsfdietnkkmvtaqeldykvrkyltdnkqlytngpskyetgyikfipknke
    sfwfdffpepeftqskylmiykdnetldsntsqievylttk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1uupB (B:)
    qqdpdpsqlhrsslvknlqniyflyegdpvthenvksvdqllshdliynvsgpnydklkt
    elknqematlfkdknvdiygveyyhlcylcenaersaciyggvtnhegnhleipkkivvk
    vsidgiqslsfdietnkkmvtaqeldykvrkyltdnkqlytngpskyetgyikfipknke
    sfwfdffpepeftqskylmiykdnetldsntsqievylttk
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1uupC (C:)
    qqdpdpsqlhrsslvknlqniyflyegdpvthenvksvdqllshdliynvsgpnydklkt
    elknqematlfkdknvdiygveyyhlcylcenaersaciyggvtnhegnhleipkkivvk
    vsidgiqslsfdietnkkmvtaqeldykvrkyltdnkqlytngpskyetgyikfipknke
    sfwfdffpepeftqskylmiykdnetldsntsqievylttk
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1uupD (D:)
    qqdpdpsqlhrsslvknlqniyflyegdpvthenvksvdqllshdliynvsgpnydklkt
    elknqematlfkdknvdiygveyyhlcylcenaersaciyggvtnhegnhleipkkivvk
    vsidgiqslsfdietnkkmvtaqeldykvrkyltdnkqlytngpskyetgyikfipknke
    sfwfdffpepeftqskylmiykdnetldsntsqievylttk