PDB entry 1uuo

View 1uuo on RCSB PDB site
Description: rat dihydroorotate dehydrogenase (dhod)in complex with brequinar
Class: oxidoreductase
Keywords: dihydroorotate dehydrogenase, brequinar, atovaquone, nucleotide metabolism, oxidoreductase
Deposited on 2004-01-08, released 2004-04-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.44 Å
R-factor: 0.21
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dihydroorotate dehydrogenase
    Species: RATTUS RATTUS [TaxId:10117]
    Database cross-references and differences (RAF-indexed):
    • PDB 1UUO
    • Uniprot Q63707 (Start-371)
    Domains in SCOPe 2.07: d1uuoa_
  • Heterogens: BRF, FMN, ORO, NI, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1uuoA (A:)
    hhhhhhatgddhfyaeylmpglqrlldpesahrlavrvtslgllpratfqdsdmlevkvl
    ghkfrnpvgiaagfdkngeavdglyklgfgfvevgsvtpqpqegnprprvfrlpedqavi
    nrygfnshglsvvehrlrarqqkqaqltadglplginlgknktsedaaadyaegvrtlgp
    ladylvvnvsspntaglrslqgktelrhllskvlqerdalkgtrkpavlvkiapdltaqd
    kediasvarelgidglivtnttvsrpvglqgalrsetgglsgkplrdlstqtiremyalt
    qgripiigvggvssgqdalekiqagaslvqlytaliflgppvvvrvkreleallkergft
    tvtdaigadhrr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uuoA (A:)
    ddhfyaeylmpglqrlldpesahrlavrvtslgllpqdsdmlevkvlghkfrnpvgiaag
    fdkngeavdglyklgfgfvevgsvtpqpqegnprprvfrlpedqavinrygfnshglsvv
    ehrlrarqqkqaqltadglplginlgknktsedaaadyaegvrtlgpladylvvnvsspq
    gktelrhllskvlqerdalkgtrkpavlvkiapdltaqdkediasvarelgidglivtnt
    tvsrpvglqgalrsetgglsgkplrdlstqtiremyaltqgripiigvggvssgqdalek
    iqagaslvqlytaliflgppvvvrvkreleallkergfttvtdaigadhrr