PDB entry 1uun

View 1uun on RCSB PDB site
Description: main porin from mycobacteria smegmatis (mspa)
Class: porin
Keywords: porin, mycobacteria
Deposited on 2004-01-08, released 2004-02-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.22729
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: mspa
    Species: Mycobacterium smegmatis [TaxId:1772]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9RLP7 (0-183)
      • engineered mutation (95)
    Domains in SCOPe 2.07: d1uuna_
  • Chain 'B':
    Compound: mspa
    Species: Mycobacterium smegmatis [TaxId:1772]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9RLP7 (0-183)
      • engineered mutation (95)
    Domains in SCOPe 2.07: d1uunb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1uunA (A:)
    gldnelslvdgqdrtltvqqwdtflngvfpldrnrltrewfhsgrakyivagpgadefeg
    tlelgyqigfpwslgvginfsyttpniliddgditrppfglnsvitpnlfpgvsisadlg
    ngpgiqevatfsvdvsgaeggvavsnahgtvtgaaggvllrpfarliastgdsvttygep
    wnmn
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1uunB (B:)
    gldnelslvdgqdrtltvqqwdtflngvfpldrnrltrewfhsgrakyivagpgadefeg
    tlelgyqigfpwslgvginfsyttpniliddgditrppfglnsvitpnlfpgvsisadlg
    ngpgiqevatfsvdvsgaeggvavsnahgtvtgaaggvllrpfarliastgdsvttygep
    wnmn