PDB entry 1uum

View 1uum on RCSB PDB site
Description: rat dihydroorotate dehydrogenase (dhod)in complex with atovaquone
Class: oxidoreductase
Keywords: oxidoreductase, dihydroorotate dehydrogenase, brequinar, atovaquone, nucleotide metabolism, pyrimidine biosynthesis, fad, flavoprotein, transit peptide
Deposited on 2004-01-06, released 2004-04-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.216
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dihydroorotate dehydrogenase
    Species: RATTUS RATTUS [TaxId:10117]
    Database cross-references and differences (RAF-indexed):
    • PDB 1UUM
    • Uniprot Q63707 (Start-371)
    Domains in SCOPe 2.07: d1uuma_
  • Chain 'B':
    Compound: dihydroorotate dehydrogenase
    Species: RATTUS RATTUS [TaxId:10117]
    Database cross-references and differences (RAF-indexed):
    • PDB 1UUM
    • Uniprot Q63707 (Start-371)
    Domains in SCOPe 2.07: d1uumb_
  • Heterogens: FMN, ORO, AFI, BOG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1uumA (A:)
    hhhhhhatgddhfyaeylmpglqrlldpesahrlavrvtslgllpratfqdsdmlevkvl
    ghkfrnpvgiaagfdkngeavdglyklgfgfvevgsvtpqpqegnprprvfrlpedqavi
    nrygfnshglsvvehrlrarqqkqaqltadglplginlgknktsedaaadyaegvrtlgp
    ladylvvnvsspntaglrslqgktelrhllskvlqerdalkgtrkpavlvkiapdltaqd
    kediasvarelgidglivtnttvsrpvglqgalrsetgglsgkplrdlstqtiremyalt
    qgripiigvggvssgqdalekiqagaslvqlytaliflgppvvvrvkreleallkergft
    tvtdaigadhrr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uumA (A:)
    yaeylmpglqrlldpesahrlavrvtslgllpratfqdsdmlevkvlghkfrnpvgiaag
    fdkngeavdglyklgfgfvevgsvtpqpqegnprprvfrlpedqavinrygfnshglsvv
    ehrlrarqqkqaqltadglplginlgknktsedaaadyaegvrtlgpladylvvnvssqg
    ktelrhllskvlqerdalkgtrkpavlvkiapdltaqdkediasvarelgidglivtntt
    vsrpvglqgalrsetgglsgkplrdlstqtiremyaltqgripiigvggvssgqdaleki
    qagaslvqlytaliflgppvvvrvkreleallkergfttvtdaigadhrr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1uumB (B:)
    hhhhhhatgddhfyaeylmpglqrlldpesahrlavrvtslgllpratfqdsdmlevkvl
    ghkfrnpvgiaagfdkngeavdglyklgfgfvevgsvtpqpqegnprprvfrlpedqavi
    nrygfnshglsvvehrlrarqqkqaqltadglplginlgknktsedaaadyaegvrtlgp
    ladylvvnvsspntaglrslqgktelrhllskvlqerdalkgtrkpavlvkiapdltaqd
    kediasvarelgidglivtnttvsrpvglqgalrsetgglsgkplrdlstqtiremyalt
    qgripiigvggvssgqdalekiqagaslvqlytaliflgppvvvrvkreleallkergft
    tvtdaigadhrr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uumB (B:)
    yaeylmpglqrlldpesahrlavrvtslgllpratfqdsdmlevkvlghkfrnpvgiaag
    fdkngeavdglyklgfgfvevgsvtpqpqegnprprvfrlpedqavinrygfnshglsvv
    ehrlrarqqkqaqltadglplginlgknktsedaaadyaegvrtlgpladylvvnvssqg
    ktelrhllskvlqerdalkgtrkpavlvkiapdltaqdkediasvarelgidglivtntt
    vsrpvglqgalrsetgglsgkplrdlstqtiremyaltqgripiigvggvssgqdaleki
    qagaslvqlytaliflgppvvvrvkreleallkergfttvtdaigadhrr