PDB entry 1uul

View 1uul on RCSB PDB site
Description: Tryparedoxin peroxidase (TXNPx) from Trypanosoma cruzi in the reduced state
Class: oxidoreductase
Keywords: peroxiredoxin, peroxidase, oxidoreductase
Deposited on 2003-12-26, released 2004-12-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-10-09, with a file datestamp of 2013-10-04.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.216
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tryparedoxin peroxidase homologue
    Species: TRYPANOSOMA CRUZI [TaxId:5693]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O96763
      • conflict (4)
      • conflict (6-8)
    • PDB 1UUL
    Domains in SCOPe 2.07: d1uula_
  • Chain 'B':
    Compound: tryparedoxin peroxidase homologue
    Species: TRYPANOSOMA CRUZI [TaxId:5693]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O96763
      • conflict (4)
      • conflict (6-8)
    • PDB 1UUL
    Domains in SCOPe 2.07: d1uulb_
  • Chain 'C':
    Compound: tryparedoxin peroxidase homologue
    Species: TRYPANOSOMA CRUZI [TaxId:5693]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O96763
      • conflict (4)
      • conflict (6-8)
    • PDB 1UUL
    Domains in SCOPe 2.07: d1uulc_
  • Chain 'D':
    Compound: tryparedoxin peroxidase homologue
    Species: TRYPANOSOMA CRUZI [TaxId:5693]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O96763
      • conflict (4)
      • conflict (6-8)
    • PDB 1UUL
    Domains in SCOPe 2.07: d1uuld_
  • Chain 'E':
    Compound: tryparedoxin peroxidase homologue
    Species: TRYPANOSOMA CRUZI [TaxId:5693]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O96763
      • conflict (4)
      • conflict (6-8)
    • PDB 1UUL
    Domains in SCOPe 2.07: d1uule_
  • Chain 'F':
    Compound: tryparedoxin peroxidase homologue
    Species: TRYPANOSOMA CRUZI [TaxId:5693]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O96763
      • conflict (4)
      • conflict (6-8)
    • PDB 1UUL
    Domains in SCOPe 2.07: d1uulf_
  • Chain 'G':
    Compound: tryparedoxin peroxidase homologue
    Species: TRYPANOSOMA CRUZI [TaxId:5693]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O96763
      • conflict (4)
      • conflict (6-8)
    • PDB 1UUL
    Domains in SCOPe 2.07: d1uulg_
  • Chain 'H':
    Compound: tryparedoxin peroxidase homologue
    Species: TRYPANOSOMA CRUZI [TaxId:5693]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O96763
      • conflict (4)
      • conflict (6-8)
    • PDB 1UUL
    Domains in SCOPe 2.07: d1uulh_
  • Chain 'I':
    Compound: tryparedoxin peroxidase homologue
    Species: TRYPANOSOMA CRUZI [TaxId:5693]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O96763
      • conflict (4)
      • conflict (6-8)
    • PDB 1UUL
    Domains in SCOPe 2.07: d1uuli_
  • Chain 'J':
    Compound: tryparedoxin peroxidase homologue
    Species: TRYPANOSOMA CRUZI [TaxId:5693]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O96763
      • conflict (4)
      • conflict (6-8)
    • PDB 1UUL
    Domains in SCOPe 2.07: d1uulj_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1uulA (A:)
    mscgeaedlhpapdfnetalmpngtfkkvaltsykgkwlvlffypmdftfvcpteicqfs
    drvkefsdigcevlacsmdseyshlawtsierkrgglgqmnipiladktkcimksygvlk
    eedgvayrglfiidpkqnlrqitvndlpvgrdvdealrlvkafqfvekhgevcpanwkpg
    dktmkpdpekskeyfgavaklp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uulA (A:)
    geaedlhpapdfnetalmpngtfkkvaltsykgkwlvlffypmdftfvcpteicqfsdrv
    kefsdigcevlacsmdseyshlawtsierkrgglgqmnipiladktkcimksygvlkeed
    gvayrglfiidpkqnlrqitvndlpvgrdvdealrlvkafqfvekhgevcpanwkpgdkt
    mkpdpekskeyfga
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1uulB (B:)
    mscgeaedlhpapdfnetalmpngtfkkvaltsykgkwlvlffypmdftfvcpteicqfs
    drvkefsdigcevlacsmdseyshlawtsierkrgglgqmnipiladktkcimksygvlk
    eedgvayrglfiidpkqnlrqitvndlpvgrdvdealrlvkafqfvekhgevcpanwkpg
    dktmkpdpekskeyfgavaklp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uulB (B:)
    geaedlhpapdfnetalmpngtfkkvaltsykgkwlvlffypmdftfvcpteicqfsdrv
    kefsdigcevlacsmdseyshlawtsierkrgglgqmnipiladktkcimksygvlkeed
    gvayrglfiidpkqnlrqitvndlpvgrdvdealrlvkafqfvekhgevcpanwkpgdkt
    mkpdpekskeyfga
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1uulC (C:)
    mscgeaedlhpapdfnetalmpngtfkkvaltsykgkwlvlffypmdftfvcpteicqfs
    drvkefsdigcevlacsmdseyshlawtsierkrgglgqmnipiladktkcimksygvlk
    eedgvayrglfiidpkqnlrqitvndlpvgrdvdealrlvkafqfvekhgevcpanwkpg
    dktmkpdpekskeyfgavaklp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uulC (C:)
    geaedlhpapdfnetalmpngtfkkvaltsykgkwlvlffypmdftfvcpteicqfsdrv
    kefsdigcevlacsmdseyshlawtsierkrgglgqmnipiladktkcimksygvlkeed
    gvayrglfiidpkqnlrqitvndlpvgrdvdealrlvkafqfvekhgevcpanwkpgdkt
    mkpdpekskeyfga
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1uulD (D:)
    mscgeaedlhpapdfnetalmpngtfkkvaltsykgkwlvlffypmdftfvcpteicqfs
    drvkefsdigcevlacsmdseyshlawtsierkrgglgqmnipiladktkcimksygvlk
    eedgvayrglfiidpkqnlrqitvndlpvgrdvdealrlvkafqfvekhgevcpanwkpg
    dktmkpdpekskeyfgavaklp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uulD (D:)
    geaedlhpapdfnetalmpngtfkkvaltsykgkwlvlffypmdftfvcpteicqfsdrv
    kefsdigcevlacsmdseyshlawtsierkrgglgqmnipiladktkcimksygvlkeed
    gvayrglfiidpkqnlrqitvndlpvgrdvdealrlvkafqfvekhgevcpanwkpgdkt
    mkpdpekskeyfga
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1uulE (E:)
    mscgeaedlhpapdfnetalmpngtfkkvaltsykgkwlvlffypmdftfvcpteicqfs
    drvkefsdigcevlacsmdseyshlawtsierkrgglgqmnipiladktkcimksygvlk
    eedgvayrglfiidpkqnlrqitvndlpvgrdvdealrlvkafqfvekhgevcpanwkpg
    dktmkpdpekskeyfgavaklp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uulE (E:)
    geaedlhpapdfnetalmpngtfkkvaltsykgkwlvlffypmdftfvcpteicqfsdrv
    kefsdigcevlacsmdseyshlawtsierkrgglgqmnipiladktkcimksygvlkeed
    gvayrglfiidpkqnlrqitvndlpvgrdvdealrlvkafqfvekhgevcpanwkpgdkt
    mkpdpekskeyfga
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1uulF (F:)
    mscgeaedlhpapdfnetalmpngtfkkvaltsykgkwlvlffypmdftfvcpteicqfs
    drvkefsdigcevlacsmdseyshlawtsierkrgglgqmnipiladktkcimksygvlk
    eedgvayrglfiidpkqnlrqitvndlpvgrdvdealrlvkafqfvekhgevcpanwkpg
    dktmkpdpekskeyfgavaklp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uulF (F:)
    geaedlhpapdfnetalmpngtfkkvaltsykgkwlvlffypmdftfvcpteicqfsdrv
    kefsdigcevlacsmdseyshlawtsierkrgglgqmnipiladktkcimksygvlkeed
    gvayrglfiidpkqnlrqitvndlpvgrdvdealrlvkafqfvekhgevcpanwkpgdkt
    mkpdpekskeyfga
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1uulG (G:)
    mscgeaedlhpapdfnetalmpngtfkkvaltsykgkwlvlffypmdftfvcpteicqfs
    drvkefsdigcevlacsmdseyshlawtsierkrgglgqmnipiladktkcimksygvlk
    eedgvayrglfiidpkqnlrqitvndlpvgrdvdealrlvkafqfvekhgevcpanwkpg
    dktmkpdpekskeyfgavaklp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uulG (G:)
    geaedlhpapdfnetalmpngtfkkvaltsykgkwlvlffypmdftfvcpteicqfsdrv
    kefsdigcevlacsmdseyshlawtsierkrgglgqmnipiladktkcimksygvlkeed
    gvayrglfiidpkqnlrqitvndlpvgrdvdealrlvkafqfvekhgevcpanwkpgdkt
    mkpdpekskeyfga
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1uulH (H:)
    mscgeaedlhpapdfnetalmpngtfkkvaltsykgkwlvlffypmdftfvcpteicqfs
    drvkefsdigcevlacsmdseyshlawtsierkrgglgqmnipiladktkcimksygvlk
    eedgvayrglfiidpkqnlrqitvndlpvgrdvdealrlvkafqfvekhgevcpanwkpg
    dktmkpdpekskeyfgavaklp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uulH (H:)
    geaedlhpapdfnetalmpngtfkkvaltsykgkwlvlffypmdftfvcpteicqfsdrv
    kefsdigcevlacsmdseyshlawtsierkrgglgqmnipiladktkcimksygvlkeed
    gvayrglfiidpkqnlrqitvndlpvgrdvdealrlvkafqfvekhgevcpanwkpgdkt
    mkpdpekskeyfga
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >1uulI (I:)
    mscgeaedlhpapdfnetalmpngtfkkvaltsykgkwlvlffypmdftfvcpteicqfs
    drvkefsdigcevlacsmdseyshlawtsierkrgglgqmnipiladktkcimksygvlk
    eedgvayrglfiidpkqnlrqitvndlpvgrdvdealrlvkafqfvekhgevcpanwkpg
    dktmkpdpekskeyfgavaklp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uulI (I:)
    geaedlhpapdfnetalmpngtfkkvaltsykgkwlvlffypmdftfvcpteicqfsdrv
    kefsdigcevlacsmdseyshlawtsierkrgglgqmnipiladktkcimksygvlkeed
    gvayrglfiidpkqnlrqitvndlpvgrdvdealrlvkafqfvekhgevcpanwkpgdkt
    mkpdpekskeyfga
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >1uulJ (J:)
    mscgeaedlhpapdfnetalmpngtfkkvaltsykgkwlvlffypmdftfvcpteicqfs
    drvkefsdigcevlacsmdseyshlawtsierkrgglgqmnipiladktkcimksygvlk
    eedgvayrglfiidpkqnlrqitvndlpvgrdvdealrlvkafqfvekhgevcpanwkpg
    dktmkpdpekskeyfgavaklp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uulJ (J:)
    geaedlhpapdfnetalmpngtfkkvaltsykgkwlvlffypmdftfvcpteicqfsdrv
    kefsdigcevlacsmdseyshlawtsierkrgglgqmnipiladktkcimksygvlkeed
    gvayrglfiidpkqnlrqitvndlpvgrdvdealrlvkafqfvekhgevcpanwkpgdkt
    mkpdpekskeyfga