PDB entry 1uuj

View 1uuj on RCSB PDB site
Description: n-terminal domain of lissencephaly-1 protein (lis-1)
Class: cell division
Keywords: platelet-activating factor acetylhydrolase, mitosis, neurogenesis, cytoskeleton, cell division, microtubule
Deposited on 2003-12-22, released 2004-07-29
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-31.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.192
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: platelet-activating factor acetylhydrolase ib alpha subunit
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1UUJ
    • Uniprot P43035 (3-End)
    Domains in SCOPe 2.06: d1uuja_
  • Chain 'B':
    Compound: platelet-activating factor acetylhydrolase ib alpha subunit
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1UUJ
    • Uniprot P43035 (3-End)
    Domains in SCOPe 2.06: d1uujb_
  • Chain 'C':
    Compound: platelet-activating factor acetylhydrolase ib alpha subunit
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1UUJ
    • Uniprot P43035 (3-End)
    Domains in SCOPe 2.06: d1uujc_
  • Chain 'D':
    Compound: platelet-activating factor acetylhydrolase ib alpha subunit
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1UUJ (Start-2)
    • Uniprot P43035 (3-End)
    Domains in SCOPe 2.06: d1uujd_
  • Heterogens: SO4, ACT, BEZ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1uujA (A:)
    gamvlsqrqrdelnraiadylrsngyeeaysvfkkeaeldmneeldkkyagllekkwtsv
    irlqkkvmelesklneakeeftsggplg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uujA (A:)
    vlsqrqrdelnraiadylrsngyeeaysvfkkeaeldmneeldkkyagllekkwtsvirl
    qkkvmelesklneake
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1uujB (B:)
    gamvlsqrqrdelnraiadylrsngyeeaysvfkkeaeldmneeldkkyagllekkwtsv
    irlqkkvmelesklneakeeftsggplg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uujB (B:)
    vlsqrqrdelnraiadylrsngyeeaysvfkkeaeldmneeldkkyagllekkwtsvirl
    qkkvmelesklnea
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1uujC (C:)
    gamvlsqrqrdelnraiadylrsngyeeaysvfkkeaeldmneeldkkyagllekkwtsv
    irlqkkvmelesklneakeeftsggplg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uujC (C:)
    vlsqrqrdelnraiadylrsngyeeaysvfkkeaeldmneeldkkyagllekkwtsvirl
    qkkvmelesklneakeef
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1uujD (D:)
    gamvlsqrqrdelnraiadylrsngyeeaysvfkkeaeldmneeldkkyagllekkwtsv
    irlqkkvmelesklneakeeftsggplg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uujD (D:)
    mvlsqrqrdelnraiadylrsngyeeaysvfkkeaeldmneeldkkyagllekkwtsvir
    lqkkvmelesklneakeef