PDB entry 1uuh

View 1uuh on RCSB PDB site
Description: hyaluronan binding domain of human cd44
Class: lectin
Keywords: lectin, hyaluronan, extracellular matrix, receptor, link-domain, c- type lectin, sugar-binding
Deposited on 2003-12-19, released 2004-03-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.186
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: CD44 antigen
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1uuha_
  • Chain 'B':
    Compound: CD44 antigen
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1uuhb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1uuhA (A:)
    aqidlnitcrfagvfhvekngrysisrteaadlckafnstlptmaqmekalsigfetcry
    gfieghvviprihpnsicaanntgvyiltsntsqydtycfnasappeedctsvtdlpnaf
    dgpititivnrdgtryvqkgeyrtnpediypsnptdddv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uuhA (A:)
    aqidlnitcrfagvfhvekngrysisrteaadlckafnstlptmaqmekalsigfetcry
    gfieghvviprihpnsicaanntgvyiltsntsqydtycfnasappeedctsvtdlpnaf
    dgpititivnrdgtryvqkgeyrtnpediy
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1uuhB (B:)
    aqidlnitcrfagvfhvekngrysisrteaadlckafnstlptmaqmekalsigfetcry
    gfieghvviprihpnsicaanntgvyiltsntsqydtycfnasappeedctsvtdlpnaf
    dgpititivnrdgtryvqkgeyrtnpediypsnptdddv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uuhB (B:)
    aqidlnitcrfagvfhvekngrysisrteaadlckafnstlptmaqmekalsigfetcry
    gfieghvviprihpnsicaanntgvyiltsntsqydtycfnasappeedctsvtdlpnaf
    dgpititivnrdgtryvqkgeyrtnpediy