PDB entry 1uug

View 1uug on RCSB PDB site
Description: escherichia coli uracil-dna glycosylase:inhibitor complex with wild-type udg and wild-type ugi
Deposited on 1998-10-31, released 1999-03-25
The last revision prior to the SCOP 1.57 freeze date was dated 2001-09-26, with a file datestamp of 2001-09-26.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.19
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.57: d1uuga_
  • Chain 'B':
    Domains in SCOP 1.57: d1uugb_
  • Chain 'C':
    Domains in SCOP 1.57: d1uugc_
  • Chain 'D':
    Domains in SCOP 1.57: d1uugd_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1uugA (A:)
    ltwhdvlaeekqqpyflntlqtvaserqsgvtiyppqkdvfnafrftelgdvkvvilgqd
    pyhgpgqahglafsvrpgiaippsllnmykelentipgftrpnhgyleswarqgvlllnt
    vltvragqahshaslgwetftdkvislinqhregvvfllwgshaqkkgaiidkqrhhvlk
    aphpsplsahrgffgcnhfvlanqwleqrgetpidwmpvlpa
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1uugB (B:)
    nlsdiieketgkqlviqesilmlpeeveevignkpesdilvhtaydestdenvmlltsda
    peykpwalviqdsngenkikml
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1uugC (C:)
    ltwhdvlaeekqqpyflntlqtvaserqsgvtiyppqkdvfnafrftelgdvkvvilgqd
    pyhgpgqahglafsvrpgiaippsllnmykelentipgftrpnhgyleswarqgvlllnt
    vltvragqahshaslgwetftdkvislinqhregvvfllwgshaqkkgaiidkqrhhvlk
    aphpsplsahrgffgcnhfvlanqwleqrgetpidwmpvlp
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1uugD (D:)
    nlsdiieketgkqlviqesilmlpeeveevignkpesdilvhtaydestdenvmlltsda
    peykpwalviqdsngenkikml