PDB entry 1uuf

View 1uuf on RCSB PDB site
Description: crystal structure of a zinc-type alcohol dehydrogenase-like protein yahk
Deposited on 2003-12-18, released 2004-01-29
The last revision prior to the SCOP 1.69 freeze date was dated 2004-01-29, with a file datestamp of 2004-01-29.
Experiment type: XRAY
Resolution: 1.76 Å
R-factor: 0.184
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1uufA (A:)
    syyhhhhhhlestslykkaglkikavgaysakqplepmditrrepgpndvkieiaycgvc
    hsdlhqvrsewagtvypcvpgheivgrvvavgdqvekyapgdlvgvgcivdsckhceece
    dglenycdhmtgtynsptpdepghtlggysqqivvheryvlrirhpqeqlaavapllcag
    ittysplrhwqagpgkkvgvvgigglghmgiklahamgahvvafttseakreaakalgad
    evvnsrnademaahlksfdfilntvaaphnlddfttllkrdgtmtlvgapatphkspevf
    nlimkrraiagsmiggipetqemldfcaehgivadiemiradqineayermlrgdvkyrf
    vidnrtltd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uufA (A:)
    ikavgaysakqplepmditrrepgpndvkieiaycgvchsdlhqvrsewagtvypcvpgh
    eivgrvvavgdqvekyapgdlvgvgcivdsckhceecedglenycdhmtgtynsptpdep
    ghtlggysqqivvheryvlrirhpqeqlaavapllcagittysplrhwqagpgkkvgvvg
    igglghmgiklahamgahvvafttseakreaakalgadevvnsrnademaahlksfdfil
    ntvaaphnlddfttllkrdgtmtlvgapevfnlimkrraiagsmiggipetqemldfcae
    hgivadiemiradqineayermlrgdvkyrfvidnrtltd