PDB entry 1uuf

View 1uuf on RCSB PDB site
Description: crystal structure of a zinc-type alcohol dehydrogenase-like protein yahk
Class: oxidoreductase
Keywords: oxidoreductase, zinc binding, oxydoreductase, metal-binding, bacterial targets at igs-cnrs, france, bigs, structural genomics
Deposited on 2003-12-18, released 2004-01-29
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.76 Å
R-factor: 0.184
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: zinc-type alcohol dehydrogenase-like protein yahk
    Species: Escherichia coli [TaxId:83333]
    Database cross-references and differences (RAF-indexed):
    • PDB 1UUF
    • Uniprot P75691 (Start-368)
    Domains in SCOPe 2.06: d1uufa1, d1uufa2
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1uufA (A:)
    syyhhhhhhlestslykkaglkikavgaysakqplepmditrrepgpndvkieiaycgvc
    hsdlhqvrsewagtvypcvpgheivgrvvavgdqvekyapgdlvgvgcivdsckhceece
    dglenycdhmtgtynsptpdepghtlggysqqivvheryvlrirhpqeqlaavapllcag
    ittysplrhwqagpgkkvgvvgigglghmgiklahamgahvvafttseakreaakalgad
    evvnsrnademaahlksfdfilntvaaphnlddfttllkrdgtmtlvgapatphkspevf
    nlimkrraiagsmiggipetqemldfcaehgivadiemiradqineayermlrgdvkyrf
    vidnrtltd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uufA (A:)
    ikavgaysakqplepmditrrepgpndvkieiaycgvchsdlhqvrsewagtvypcvpgh
    eivgrvvavgdqvekyapgdlvgvgcivdsckhceecedglenycdhmtgtynsptpdep
    ghtlggysqqivvheryvlrirhpqeqlaavapllcagittysplrhwqagpgkkvgvvg
    igglghmgiklahamgahvvafttseakreaakalgadevvnsrnademaahlksfdfil
    ntvaaphnlddfttllkrdgtmtlvgapevfnlimkrraiagsmiggipetqemldfcae
    hgivadiemiradqineayermlrgdvkyrfvidnrtltd