PDB entry 1uue

View 1uue on RCSB PDB site
Description: a-spectrin sh3 domain (v44t, d48g mutant)
Deposited on 2003-12-18, released 2004-02-19
The last revision prior to the SCOP 1.67 freeze date was dated 2004-02-19, with a file datestamp of 2004-02-19.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.24
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1uuea_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1uueA (A:)
    mdetgkelvlalydyqeksprevtmkkgdiltllnstnkdwwktevngrqgfvpaayvkk
    ld
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uueA (A:)
    kelvlalydyqeksprevtmkkgdiltllnstnkdwwktevngrqgfvpaayvkkld