PDB entry 1uue

View 1uue on RCSB PDB site
Description: a-spectrin sh3 domain (v44t, d48g mutant)
Class: sh3-domain
Keywords: sh3-domain, sh3, spectrin, cytoskeleton, membrane, calmodulin-binding, actin-binding, calcium-binding
Deposited on 2003-12-18, released 2004-02-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.24
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: spectrin alpha chain
    Species: GALLUS GALLUS [TaxId:9031]
    Database cross-references and differences (RAF-indexed):
    • PDB 1UUE
      • engineered mutation (43)
      • engineered mutation (47)
    • Uniprot P07751 (Start-61)
    Domains in SCOPe 2.07: d1uuea_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1uueA (A:)
    mdetgkelvlalydyqeksprevtmkkgdiltllnstnkdwwktevngrqgfvpaayvkk
    ld
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uueA (A:)
    kelvlalydyqeksprevtmkkgdiltllnstnkdwwktevngrqgfvpaayvkkld