PDB entry 1uuc

View 1uuc on RCSB PDB site
Description: solution structure of a chimeric lekti-domain
Class: serine proteinase inhibitor
Keywords: protease, serine proteinase inhibitor, chameleon sequence
Deposited on 2003-12-18, released 2004-09-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: -1.95 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: serine protease inhibitor kazal-type 5
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9NQ38 (0-54)
      • conflict see remark 9 (1-4)
      • engineered mutation (27-28)
    Domains in SCOPe 2.07: d1uuca_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1uucA (A:)
    knedqemchefqafmkngklfcpqdkkpiqsldgimfinkcatckmilekeaksq