PDB entry 1uua

View 1uua on RCSB PDB site
Description: solution structure of a truncated bovine pancreatic trypsin inhibitor, 3-58 bpti
Class: inhibitor
Keywords: inhibitor, serine protease inhibitor, signal, pharmaceutical, 3d-struct
Deposited on 2003-12-17, released 2004-01-29
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: bovine pancreatic trypsin inhibitor
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1uuaa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1uuaA (A:)
    dfcleppytgpckariiryfynakaglcqtfvyggcrakrnnfksaedcmrtcgga