PDB entry 1uu9

View 1uu9 on RCSB PDB site
Description: structure of human pdk1 kinase domain in complex with bim-3
Class: transferase
Keywords: protein kinase, pkb, pdk1, inhibitor, ly333531, bisindolyl maleimide, bim-1, diabetes, cancer, transferase, serine/threonine-protein kinase
Deposited on 2003-12-16, released 2004-03-04
The last revision prior to the SCOP 1.73 freeze date was dated 2004-03-04, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.17642
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3-phosphoinositide dependent protein kinase-1
    Species: Spodoptera frugiperda
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1uu9a_
  • Heterogens: SO4, BI3, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1uu9A (A:)
    pqprkkrpedfkfgkilgegsfstvvlarelatsreyaikilekrhiikenkvpyvtrer
    dvmsrldhpffvklyftfqddeklyfglsyakngellkyirkigsfdetctrfytaeivs
    aleylhgkgiihrdlkpenillnedmhiqitdfgtakvlspeskqaransfvgtaqyvsp
    ellteksackssdlwalgciiyqlvaglppfragneylifqkiikleydfpekffpkard
    lvekllvldatkrlgceemegygplkahpffesvtwenlhqqtppk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uu9A (A:)
    pqprkkrpedfkfgkilgegsfstvvlarelatsreyaikilekrhiikenkvpyvtrer
    dvmsrldhpffvklyftfqddeklyfglsyakngellkyirkigsfdetctrfytaeivs
    aleylhgkgiihrdlkpenillnedmhiqitdfgtakvlnsfvgtaqyvspellteksac
    kssdlwalgciiyqlvaglppfragneylifqkiikleydfpekffpkardlvekllvld
    atkrlgceemegygplkahpffesvtwenlhqqtppk