PDB entry 1uu5

View 1uu5 on RCSB PDB site
Description: x-ray crystal structure of the catalytic domain of humicola grisea cel12a soaked with cellotetraose
Class: hydrolase
Keywords: hydrolase, cellulase, cellulose degradation, endoglucanase, glycosyl hydrolase, gh family 12, humicola grisea cel12a, ligand complex
Deposited on 2003-12-15, released 2004-09-16
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.164
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: endo-beta-1,4-glucanase
  Species: HUMICOLA GRISEA [TaxId:5527]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q8NJY3 (0-223)
  Domains in SCOPe 2.04: d1uu5a_
• Heterogens: ACT, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1uu5A (A:)
  eirslcelygywsgngyellnnlwgkdtatsgwqctyldgtnnggiqwstawewqgapdn
  vksypyvgkqiqrgrkisdinsmrtsvswtydrtdiranvaydvftardpdhpnwggdye
  lmiwlaryggiypigtfhsqvnlagrtwdlwtgyngnmrvysflppsgdirdfscdikdf
  fnylernhgypareqnlivyqvgtecftggparftcrdfradlw