PDB entry 1uu3

View 1uu3 on RCSB PDB site
Description: structure of human pdk1 kinase domain in complex with ly333531
Deposited on 2003-12-15, released 2004-03-04
The last revision prior to the SCOP 1.69 freeze date was dated 2004-03-04, with a file datestamp of 2004-03-04.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.1736
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1uu3a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1uu3A (A:)
    mdgtaaeprpgagslqhaqpppqprkkrpedfkfgkilgegsfstvvlarelatsreyai
    kilekrhiikenkvpyvtrerdvmsrldhpffvklyftfqddeklyfglsyakngellky
    irkigsfdetctrfytaeivsaleylhgkgiihrdlkpenillnedmhiqitdfgtakvl
    speskqaransfvgtaqyvspellteksackssdlwalgciiyqlvaglppfragneyli
    fqkiikleydfpekffpkardlvekllvldatkrlgceemegygplkahpffesvtwenl
    hqqtppklta
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uu3A (A:)
    qprkkrpedfkfgkilgegsfstvvlarelatsreyaikilekrhiikenkvpyvtrerd
    vmsrldhpffvklyftfqddeklyfglsyakngellkyirkigsfdetctrfytaeivsa
    leylhgkgiihrdlkpenillnedmhiqitdfgtakvlsfvgtaqyvspellteksacks
    sdlwalgciiyqlvaglppfragneylifqkiikleydfpekffpkardlvekllvldat
    krlgceemegygplkahpffesvtwenlhqqtppklta