PDB entry 1uu2

View 1uu2 on RCSB PDB site
Description: histidinol-phosphate aminotransferase (hisc) from thermotoga maritima (apo-form)
Deposited on 2003-12-13, released 2004-03-18
The last revision prior to the SCOP 1.71 freeze date was dated 2004-03-18, with a file datestamp of 2004-03-18.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.236
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1uu2a_
  • Chain 'B':
    Domains in SCOP 1.71: d1uu2b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1uu2A (A:)
    mnpldliakraypyetekrdktylalnenpfpfpedlvdevfrrlnsdalriyydspdee
    liekilsyldtdflsknnvsvgngadeiiyvmmlmfdrsvffpptyscyrifakavgakf
    levpltkdlripevnvgegdvvfipnpnnptghvfereeierilktgafvaldeayyefh
    gesyvdflkkyenlavirtfskafslaaqrvgyvvasekfidaynrvrlpfnvsyvsqmf
    akvaldhreifeertkfiveerermksalremgyritdsrgnfvfvfmekeekerllehl
    rtknvavrsfregvritigkreendmilrelevfk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uu2A (A:)
    yetekrdktylalnenpfpfpedlvdevfrrlnsdalriyydspdeeliekilsyldtdf
    lsknnvsvgngadeiiyvmmlmfdrsvffpptyscyrifakavgakflevpltkdlripe
    vnvgegdvvfipnpnnptghvfereeierilktgafvaldeayyefhgesyvdflkkyen
    lavirtfskafslaaqrvgyvvasekfidaynrvrlpfnvsyvsqmfakvaldhreifee
    rtkfiveerermksalremgyritdsrgnfvfvfmekeekerllehlrtknvavrsfreg
    vritigkreendmilrelevfk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1uu2B (B:)
    mnpldliakraypyetekrdktylalnenpfpfpedlvdevfrrlnsdalriyydspdee
    liekilsyldtdflsknnvsvgngadeiiyvmmlmfdrsvffpptyscyrifakavgakf
    levpltkdlripevnvgegdvvfipnpnnptghvfereeierilktgafvaldeayyefh
    gesyvdflkkyenlavirtfskafslaaqrvgyvvasekfidaynrvrlpfnvsyvsqmf
    akvaldhreifeertkfiveerermksalremgyritdsrgnfvfvfmekeekerllehl
    rtknvavrsfregvritigkreendmilrelevfk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uu2B (B:)
    ekrdktylalnenpfpfpedlvdevfrrlnsdalriyydspdeeliekilsyldtdflsk
    nnvsvgngadeiiyvmmlmfdrsvffpptyscyrifakavgakflevpltkdlripevnv
    gegdvvfipnpnnptghvfereeierilktgafvaldeayyefhgesyvdflkkyenlav
    irtfskafslaaqrvgyvvasekfidaynrvrlpfnvsyvsqmfakvaldhreifeertk
    fiveerermksalremgyritdsrgnfvfvfmekeekerllehlrtknvavrsfregvri
    tigkreendmilrelevfk