PDB entry 1uu1

View 1uu1 on RCSB PDB site
Description: complex of histidinol-phosphate aminotransferase (hisc) from thermotoga maritima (apo-form)
Deposited on 2003-12-12, released 2004-03-18
The last revision prior to the SCOP 1.71 freeze date was dated 2004-03-18, with a file datestamp of 2004-03-18.
Experiment type: XRAY
Resolution: 2.38 Å
R-factor: 0.206
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1uu1a_
  • Chain 'B':
    Domains in SCOP 1.71: d1uu1b_
  • Chain 'C':
    Domains in SCOP 1.71: d1uu1c_
  • Chain 'D':
    Domains in SCOP 1.71: d1uu1d_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1uu1A (A:)
    mnpldliakraypyetekrdktylalnenpfpfpedlvdevfrrlnsdalriyydspdee
    liekilsyldtdflsknnvsvgngadeiiyvmmlmfdrsvffpptyscyrifakavgakf
    levpltkdlripevnvgegdvvfipnpnnptghvfereeierilktgafvaldeayyefh
    gesyvdflkkyenlavirtfskafslaaqrvgyvvasekfidaynrvrlpfnvsyvsqmf
    akvaldhreifeertkfiveerermksalremgyritdsrgnfvfvfmekeekerllehl
    rtknvavrsfregvritigkreendmilrelevfk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uu1A (A:)
    liakraypyetekrdktylalnenpfpfpedlvdevfrrlnsdalriyydspdeelieki
    lsyldtdflsknnvsvgngadeiiyvmmlmfdrsvffpptyscyrifakavgakflevpl
    tkdlripevnvgegdvvfipnpnnptghvfereeierilktgafvaldeayyefhgesyv
    dflkkyenlavirtfskafslaaqrvgyvvasekfidaynrvrlpfnvsyvsqmfakval
    dhreifeertkfiveerermksalremgyritdsrgnfvfvfmekeekerllehlrtknv
    avrsfregvritigkreendmilrelevfk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1uu1B (B:)
    mnpldliakraypyetekrdktylalnenpfpfpedlvdevfrrlnsdalriyydspdee
    liekilsyldtdflsknnvsvgngadeiiyvmmlmfdrsvffpptyscyrifakavgakf
    levpltkdlripevnvgegdvvfipnpnnptghvfereeierilktgafvaldeayyefh
    gesyvdflkkyenlavirtfskafslaaqrvgyvvasekfidaynrvrlpfnvsyvsqmf
    akvaldhreifeertkfiveerermksalremgyritdsrgnfvfvfmekeekerllehl
    rtknvavrsfregvritigkreendmilrelevfk
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1uu1C (C:)
    mnpldliakraypyetekrdktylalnenpfpfpedlvdevfrrlnsdalriyydspdee
    liekilsyldtdflsknnvsvgngadeiiyvmmlmfdrsvffpptyscyrifakavgakf
    levpltkdlripevnvgegdvvfipnpnnptghvfereeierilktgafvaldeayyefh
    gesyvdflkkyenlavirtfskafslaaqrvgyvvasekfidaynrvrlpfnvsyvsqmf
    akvaldhreifeertkfiveerermksalremgyritdsrgnfvfvfmekeekerllehl
    rtknvavrsfregvritigkreendmilrelevfk
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1uu1D (D:)
    mnpldliakraypyetekrdktylalnenpfpfpedlvdevfrrlnsdalriyydspdee
    liekilsyldtdflsknnvsvgngadeiiyvmmlmfdrsvffpptyscyrifakavgakf
    levpltkdlripevnvgegdvvfipnpnnptghvfereeierilktgafvaldeayyefh
    gesyvdflkkyenlavirtfskafslaaqrvgyvvasekfidaynrvrlpfnvsyvsqmf
    akvaldhreifeertkfiveerermksalremgyritdsrgnfvfvfmekeekerllehl
    rtknvavrsfregvritigkreendmilrelevfk