PDB entry 1uty

View 1uty on RCSB PDB site
Description: Crystal structure of an RNA binding domain of Bluetongue virus non-structural protein 2(NS2)
Deposited on 2003-12-12, released 2004-07-13
The last revision prior to the SCOP 1.69 freeze date was dated 2004-09-02, with a file datestamp of 2004-09-02.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.21413
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1utya_
  • Chain 'B':
    Domains in SCOP 1.69: d1utyb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1utyA (A:)
    meqkqrrftknifvldvtaktlcgaiaklssqpycqikigrvvafkpvknpepkgyvlnv
    pgpgayriqdgqdiislmltphgveatterweewkfegvsvtpmatrvqyngvmvdaeik
    yckgmgivqpymrndfdrnempdlpgvmrsnydirelrqkikneresaprlqvhsvarpg
    senlypq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1utyA (A:)
    ftknifvldvtaktlcgaiaklssqpycqikigrvvafkpvknpepkgyvlnvpgpgayr
    iqdgqdiislmltphgveatterweewkfegvsvtpmatrvqyngvmvdaeikyckgmgi
    vqpymrndfdrnempdlpgvmrsnydirelrqk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1utyB (B:)
    meqkqrrftknifvldvtaktlcgaiaklssqpycqikigrvvafkpvknpepkgyvlnv
    pgpgayriqdgqdiislmltphgveatterweewkfegvsvtpmatrvqyngvmvdaeik
    yckgmgivqpymrndfdrnempdlpgvmrsnydirelrqkikneresaprlqvhsvarpg
    senlypq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1utyB (B:)
    ftknifvldvtaktlcgaiaklssqpycqikigrvvafkpvknpepkgyvlnvpgpgayr
    iqdgqdiislmltphgveatterweewkfegvsvtpmatrvqyngvmvdaeikyckgmgi
    vqpymrndfdrnempdlpgvmrsnydirelrqk