PDB entry 1utx

View 1utx on RCSB PDB site
Description: regulation of cytolysin expression by enterococcus faecalis: role of cylr2
Class: DNA-binding protein
Keywords: DNA-binding protein, transcriptional repressor, regulation of cytolysin operon, helix-turn-helix
Deposited on 2003-12-12, released 2004-09-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.155
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cylr2
    Species: ENTEROCOCCUS FAECALIS [TaxId:1351]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1utxa_
  • Chain 'B':
    Compound: cylr2
    Species: ENTEROCOCCUS FAECALIS [TaxId:1351]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1utxb_
  • Heterogens: IOD, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1utxA (A:)
    miinnlklirekkkisqselaallevsrqtingieknkynpslqlalkiayylntpledi
    fqwqpe
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1utxB (B:)
    miinnlklirekkkisqselaallevsrqtingieknkynpslqlalkiayylntpledi
    fqwqpe