PDB entry 1utv

View 1utv on RCSB PDB site
Description: The structure of the trp RNA-binding attenuation protein (TRAP) bound to a RNA molecule containing UAGAU repeats (part II)
Deposited on 2003-12-08, released 2004-01-15
The last revision prior to the SCOP 1.69 freeze date was dated 2004-04-01, with a file datestamp of 2004-04-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.18648
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1utva_
  • Chain 'B':
    Domains in SCOP 1.69: d1utvb_
  • Chain 'C':
    Domains in SCOP 1.69: d1utvc_
  • Chain 'D':
    Domains in SCOP 1.69: d1utvd_
  • Chain 'E':
    Domains in SCOP 1.69: d1utve_
  • Chain 'F':
    Domains in SCOP 1.69: d1utvf_
  • Chain 'G':
    Domains in SCOP 1.69: d1utvg_
  • Chain 'H':
    Domains in SCOP 1.69: d1utvh_
  • Chain 'I':
    Domains in SCOP 1.69: d1utvi_
  • Chain 'J':
    Domains in SCOP 1.69: d1utvj_
  • Chain 'K':
    Domains in SCOP 1.69: d1utvk_
  • Chain 'L':
    Domains in SCOP 1.69: d1utvl_
  • Chain 'M':
    Domains in SCOP 1.69: d1utvm_
  • Chain 'N':
    Domains in SCOP 1.69: d1utvn_
  • Chain 'O':
    Domains in SCOP 1.69: d1utvo_
  • Chain 'P':
    Domains in SCOP 1.69: d1utvp_
  • Chain 'Q':
    Domains in SCOP 1.69: d1utvq_
  • Chain 'R':
    Domains in SCOP 1.69: d1utvr_
  • Chain 'S':
    Domains in SCOP 1.69: d1utvs_
  • Chain 'T':
    Domains in SCOP 1.69: d1utvt_
  • Chain 'U':
    Domains in SCOP 1.69: d1utvu_
  • Chain 'V':
    Domains in SCOP 1.69: d1utvv_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1utvA (A:)
    mytnsdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkay
    iqtrhgviesegkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1utvA (A:)
    tnsdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkayiq
    trhgviesegk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1utvB (B:)
    mytnsdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkay
    iqtrhgviesegkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1utvB (B:)
    tnsdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkayiq
    trhgviesegk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1utvC (C:)
    mytnsdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkay
    iqtrhgviesegkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1utvC (C:)
    tnsdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkayiq
    trhgvieseg
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1utvD (D:)
    mytnsdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkay
    iqtrhgviesegkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1utvD (D:)
    tnsdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkayiq
    trhgviesegk
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1utvE (E:)
    mytnsdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkay
    iqtrhgviesegkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1utvE (E:)
    tnsdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkayiq
    trhgvieseg
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1utvF (F:)
    mytnsdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkay
    iqtrhgviesegkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1utvF (F:)
    tnsdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkayiq
    trhgvieseg
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1utvG (G:)
    mytnsdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkay
    iqtrhgviesegkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1utvG (G:)
    tnsdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkayiq
    trhgvieseg
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1utvH (H:)
    mytnsdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkay
    iqtrhgviesegkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1utvH (H:)
    tnsdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkayiq
    trhgvieseg
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >1utvI (I:)
    mytnsdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkay
    iqtrhgviesegkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1utvI (I:)
    tnsdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkayiq
    trhgvieseg
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >1utvJ (J:)
    mytnsdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkay
    iqtrhgviesegkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1utvJ (J:)
    tnsdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkayiq
    trhgvieseg
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >1utvK (K:)
    mytnsdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkay
    iqtrhgviesegkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1utvK (K:)
    tnsdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkayiq
    trhgvieseg
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1utvL (L:)
    mytnsdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkay
    iqtrhgviesegkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1utvL (L:)
    tnsdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkayiq
    trhgvieseg
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >1utvM (M:)
    mytnsdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkay
    iqtrhgviesegkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1utvM (M:)
    tnsdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkayiq
    trhgviesegk
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >1utvN (N:)
    mytnsdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkay
    iqtrhgviesegkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1utvN (N:)
    tnsdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkayiq
    trhgvieseg
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >1utvO (O:)
    mytnsdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkay
    iqtrhgviesegkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1utvO (O:)
    tnsdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkayiq
    trhgvieseg
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >1utvP (P:)
    mytnsdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkay
    iqtrhgviesegkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1utvP (P:)
    tnsdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkayiq
    trhgvieseg
    

  • Chain 'Q':
    Sequence, based on SEQRES records: (download)
    >1utvQ (Q:)
    mytnsdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkay
    iqtrhgviesegkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1utvQ (Q:)
    tnsdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkayiq
    trhgvieseg
    

  • Chain 'R':
    Sequence, based on SEQRES records: (download)
    >1utvR (R:)
    mytnsdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkay
    iqtrhgviesegkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1utvR (R:)
    tnsdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkayiq
    trhgvieseg
    

  • Chain 'S':
    Sequence, based on SEQRES records: (download)
    >1utvS (S:)
    mytnsdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkay
    iqtrhgviesegkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1utvS (S:)
    tnsdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkayiq
    trhgvieseg
    

  • Chain 'T':
    Sequence, based on SEQRES records: (download)
    >1utvT (T:)
    mytnsdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkay
    iqtrhgviesegkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1utvT (T:)
    tnsdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkayiq
    trhgvieseg
    

  • Chain 'U':
    Sequence, based on SEQRES records: (download)
    >1utvU (U:)
    mytnsdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkay
    iqtrhgviesegkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1utvU (U:)
    tnsdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkayiq
    trhgvieseg
    

  • Chain 'V':
    Sequence, based on SEQRES records: (download)
    >1utvV (V:)
    mytnsdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkay
    iqtrhgviesegkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1utvV (V:)
    tnsdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkayiq
    trhgvieseg