PDB entry 1utu

View 1utu on RCSB PDB site
Description: crystal structure of novel protein emsy truncate
Class: chromatin regulator
Keywords: chromatin regulator, chromatin regulators, royal family domain
Deposited on 2003-12-10, released 2005-10-13
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.207
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: emsy
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1utua1
  • Chain 'B':
    Compound: emsy
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1utub1
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1utuA (A:)
    mpvvwptlldlsrdeckrilrkleleayagvisalraqgdltkekkdllgelskvlsist
    erhraevrravnderlttiahnmsgpnsssewsiegrrlvplmprlvp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1utuA (A:)
    lsrdeckrilrkleleayagvisalraqgdltkekkdllgelskvlsisterhraevrra
    vnderlttiahnmsgpnsssewsiegrrlvplmprlv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1utuB (B:)
    mpvvwptlldlsrdeckrilrkleleayagvisalraqgdltkekkdllgelskvlsist
    erhraevrravnderlttiahnmsgpnsssewsiegrrlvplmprlvp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1utuB (B:)
    dlsrdeckrilrkleleayagvisalraqgdltkekkdllgelskvlsisterhraevrr
    avnderlttiahnmsgpnsssewsiegrrlvplmpr