PDB entry 1utt

View 1utt on RCSB PDB site
Description: crystal structure of mmp-12 complexed to 2-(1,3-dioxo-1,3-dihydro-2h-isoindol-2-yl)ethyl-4-(4-ethoxy[1,1-biphenyl]-4-yl)-4-oxobutanoic acid
Class: hydrolase
Keywords: macrophage metalloelastase, non-zinc chelator, mmp-12, mmp inhibitor, hydrolase, metalloprotease
Deposited on 2003-12-10, released 2004-12-15
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.217
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Macrophage metalloelastase
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P39900 (0-158)
  Domains in SCOPe 2.06: d1utta_
• Heterogens: HAE, CP8, ZN, CA, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1uttA (A:)
  gpvwrkhyityrinnytpdmnredvdyairkafqvwsnvtplkfskintgmadilvvfar
  gahgdfhafdgkggilahafgpgsgiggdahfdedefwtthsggtnlfltavheighslg
  lghssdpkavmfptykyvdintfrlsaddirgiqslygd