PDB entry 1utt

View 1utt on RCSB PDB site
Description: crystal structure of mmp-12 complexed to 2-(1,3-dioxo-1,3-dihydro-2h-isoindol-2-yl)ethyl-4-(4-ethoxy[1,1-biphenyl]-4-yl)-4-oxobutanoic acid
Class: hydrolase
Keywords: macrophage metalloelastase, non-zinc chelator, mmp-12, mmp inhibitor, hydrolase, metalloprotease
Deposited on 2003-12-10, released 2004-12-15
The last revision prior to the SCOP 1.73 freeze date was dated 2005-05-26, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.217
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Macrophage metalloelastase
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1utta_
  • Heterogens: ZN, CA, HAE, CP8, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1uttA (A:)
gpvwrkhyityrinnytpdmnredvdyairkafqvwsnvtplkfskintgmadilvvfar
gahgdfhafdgkggilahafgpgsgiggdahfdedefwtthsggtnlfltavheighslg
lghssdpkavmfptykyvdintfrlsaddirgiqslygd