PDB entry 1utr

View 1utr on RCSB PDB site
Description: uteroglobin-pcb complex (reduced form)
Deposited on 1995-09-01, released 1995-12-07
The last revision prior to the SCOP 1.55 freeze date was dated 1995-12-07, with a file datestamp of 1995-12-07.
Experiment type: NMR1
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.09 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1utra_
  • Chain 'B':
    Domains in SCOP 1.55: d1utrb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1utrA (A:)
icpgflqvlealllgsesnyeaalkpfnpasdlqnagtqlkrlvdtlpqetrinivklte
kiltsplc

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1utrB (B:)
icpgflqvlealllgsesnyeaalkpfnpasdlqnagtqlkrlvdtlpqetrinivklte
kiltsplc