PDB entry 1utr

View 1utr on RCSB PDB site
Description: uteroglobin-pcb complex (reduced form)
Class: mammalian pcb-binding protein
Keywords: uteroglobin, clara cell 17 kda protein (cc10), phospholipase a2 inhibitor, clara cell phospholipid-binding protein, progesterone binding, mammalian pcb-binding protein
Deposited on 1995-09-01, released 1995-12-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: uteroglobin
    Species: Rattus norvegicus [TaxId:10116]
    Gene: POTENTIAL
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1utra_
  • Chain 'B':
    Compound: uteroglobin
    Species: Rattus norvegicus [TaxId:10116]
    Gene: POTENTIAL
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1utrb_
  • Heterogens: PCB

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1utrA (A:)
    mkiaititvlmlsiccssassdicpgflqvlealllgsesnyeaalkpfnpasdlqnagt
    qlkrlvdtlpqetrinivkltekiltsplceqdlrv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1utrA (A:)
    icpgflqvlealllgsesnyeaalkpfnpasdlqnagtqlkrlvdtlpqetrinivklte
    kiltsplc
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1utrB (B:)
    mkiaititvlmlsiccssassdicpgflqvlealllgsesnyeaalkpfnpasdlqnagt
    qlkrlvdtlpqetrinivkltekiltsplceqdlrv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1utrB (B:)
    icpgflqvlealllgsesnyeaalkpfnpasdlqnagtqlkrlvdtlpqetrinivklte
    kiltsplc