PDB entry 1utq

View 1utq on RCSB PDB site
Description: trypsin specificity as elucidated by lie calculations, x-ray structures and association constant measurements
Class: hydrolase
Keywords: hydrolase, trypsin, inhibitor specificity, electrostatic interactions, cold-adaptation, molecular dynamics, binding free energy hydrolase
Deposited on 2003-12-09, released 2004-01-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.15 Å
R-factor: 0.1377
AEROSPACI score: 0.89 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: trypsinogen
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1utqa_
  • Heterogens: GOL, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1utqA (A:)
    fiflallgaavafpvddddkivggytcgantvpyqvslnsgyhfcggslinsqwvvsaah
    cyksgiqvrlgedninvvegneqfisasksivhpsynsntlnndimliklksaaslnsrv
    asislptscasagtqclisgwgntkssgtsypdvlkclkapilsdsscksaypgqitsnm
    fcagyleggkdscqgdsggpvvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqti
    asn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1utqA (A:)
    ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
    neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
    wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
    vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn