PDB entry 1utl

View 1utl on RCSB PDB site
Description: trypsin specificity as elucidated by lie calculations, x-ray structures and association constant measurements
Class: hydrolase
Keywords: hydrolase, trypsin, inhibitor specificity, electrostatic interactions, cold-adaptation, molecular dynamics, binding free energy
Deposited on 2003-12-09, released 2004-01-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.176
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'M':
    Compound: trypsin I
    Species: Salmo salar [TaxId:8030]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P35031 (Start-241)
      • conflict (28)
      • conflict (32)
    Domains in SCOPe 2.07: d1utlm_
  • Heterogens: PRA, CA, MPD, HOH

PDB Chain Sequences:

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >1utlM (M:)
    mislvfvlligaafateddkivggyeckpysqphqvslnsgyhfcggslvnenwvvsaah
    cyksrvevrlgehnikvtegseqfisssrvirhpnyssynidndimliklskpatlntyv
    qpvalptscapagtmctvsgwgntmsstadsnklqclnipilsysdcnnsypgmitnamf
    cagyleggkdscqgdsggpvvcngelqgvvswgygcaepgnpgvyakvcifndwltstma
    sy
    

    Sequence, based on observed residues (ATOM records): (download)
    >1utlM (M:)
    ivggyeckpysqphqvslnsgyhfcggslvnenwvvsaahcyksrvevrlgehnikvteg
    seqfisssrvirhpnyssynidndimliklskpatlntyvqpvalptscapagtmctvsg
    wgntmsstadsnklqclnipilsysdcnnsypgmitnamfcagyleggkdscqgdsggpv
    vcngelqgvvswgygcaepgnpgvyakvcifndwltstmasy