PDB entry 1utg

View 1utg on RCSB PDB site
Description: refinement of the c2221 crystal form of oxidized uteroglobin at 1.34 angstroms resolution
Class: steroid binding
Keywords: steroid binding
Deposited on 1989-04-03, released 1989-10-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 1.34 Å
R-factor: N/A
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: uteroglobin
  Species: Oryctolagus cuniculus [TaxId:9986]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P02779 (0-69)
  Domains in SCOPe 2.08: d1utga_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1utgA (A:)
  gicprfahvienlllgtpssyetslkefepddtmkdagmqmkkvldslpqttrenimklt
  ekivksplcm