PDB entry 1utf

View 1utf on RCSB PDB site
Description: The structure of the trp RNA-binding attenuation protein (TRAP) bound to a RNA molecule containing UAGAU repeats (part I)
Class: RNA binding protein
Keywords: RNA binding protein, transcription attenuation, RNA-binding protein, trp RNA
Deposited on 2003-12-08, released 2004-01-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-12-10, with a file datestamp of 2014-12-05.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.186
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain '0':
    Compound: 5'-r(*up*ap*gp*ap*up)-3'
    Species: synthetic, synthetic
  • Chain '1':
    Compound: 5'-r(*up*ap*gp*ap*up)-3'
    Species: synthetic, synthetic
  • Chain '2':
    Compound: 5'-r(*up*ap*gp*ap*up)-3'
    Species: synthetic, synthetic
  • Chain '3':
    Compound: 5'-r(*up*ap*gp*ap*up)-3'
    Species: synthetic, synthetic
  • Chain '4':
    Compound: 5'-r(*up*ap*gp*ap*up)-3'
    Species: synthetic, synthetic
  • Chain '5':
    Compound: 5'-r(*up*ap*gp*ap*up)-3'
    Species: synthetic, synthetic
  • Chain '6':
    Compound: 5'-r(*up*ap*gp*ap*up)-3'
    Species: synthetic, synthetic
  • Chain '7':
    Compound: 5'-r(*up*ap*gp*ap*up)-3'
    Species: synthetic, synthetic
  • Chain '8':
    Compound: 5'-r(*up*ap*gp*ap*up)-3'
    Species: synthetic, synthetic
  • Chain '9':
    Compound: 5'-r(*up*ap*gp*ap*up)-3'
    Species: synthetic, synthetic
  • Chain 'A':
    Compound: transcription attenuation protein mtrb
    Species: BACILLUS STEAROTHERMOPHILUS [TaxId:1422]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1utfa_
  • Chain 'B':
    Compound: transcription attenuation protein mtrb
    Species: BACILLUS STEAROTHERMOPHILUS [TaxId:1422]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1utfb_
  • Chain 'C':
    Compound: transcription attenuation protein mtrb
    Species: BACILLUS STEAROTHERMOPHILUS [TaxId:1422]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1utfc_
  • Chain 'D':
    Compound: transcription attenuation protein mtrb
    Species: BACILLUS STEAROTHERMOPHILUS [TaxId:1422]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1utfd_
  • Chain 'E':
    Compound: transcription attenuation protein mtrb
    Species: BACILLUS STEAROTHERMOPHILUS [TaxId:1422]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1utfe_
  • Chain 'F':
    Compound: transcription attenuation protein mtrb
    Species: BACILLUS STEAROTHERMOPHILUS [TaxId:1422]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1utff_
  • Chain 'G':
    Compound: transcription attenuation protein mtrb
    Species: BACILLUS STEAROTHERMOPHILUS [TaxId:1422]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1utfg_
  • Chain 'H':
    Compound: transcription attenuation protein mtrb
    Species: BACILLUS STEAROTHERMOPHILUS [TaxId:1422]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1utfh_
  • Chain 'I':
    Compound: transcription attenuation protein mtrb
    Species: BACILLUS STEAROTHERMOPHILUS [TaxId:1422]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1utfi_
  • Chain 'J':
    Compound: transcription attenuation protein mtrb
    Species: BACILLUS STEAROTHERMOPHILUS [TaxId:1422]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1utfj_
  • Chain 'K':
    Compound: transcription attenuation protein mtrb
    Species: BACILLUS STEAROTHERMOPHILUS [TaxId:1422]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1utfk_
  • Chain 'L':
    Compound: transcription attenuation protein mtrb
    Species: BACILLUS STEAROTHERMOPHILUS [TaxId:1422]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1utfl_
  • Chain 'M':
    Compound: transcription attenuation protein mtrb
    Species: BACILLUS STEAROTHERMOPHILUS [TaxId:1422]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1utfm_
  • Chain 'N':
    Compound: transcription attenuation protein mtrb
    Species: BACILLUS STEAROTHERMOPHILUS [TaxId:1422]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1utfn_
  • Chain 'O':
    Compound: transcription attenuation protein mtrb
    Species: BACILLUS STEAROTHERMOPHILUS [TaxId:1422]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1utfo_
  • Chain 'P':
    Compound: transcription attenuation protein mtrb
    Species: BACILLUS STEAROTHERMOPHILUS [TaxId:1422]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1utfp_
  • Chain 'Q':
    Compound: transcription attenuation protein mtrb
    Species: BACILLUS STEAROTHERMOPHILUS [TaxId:1422]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1utfq_
  • Chain 'R':
    Compound: transcription attenuation protein mtrb
    Species: BACILLUS STEAROTHERMOPHILUS [TaxId:1422]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1utfr_
  • Chain 'S':
    Compound: transcription attenuation protein mtrb
    Species: BACILLUS STEAROTHERMOPHILUS [TaxId:1422]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1utfs_
  • Chain 'T':
    Compound: transcription attenuation protein mtrb
    Species: BACILLUS STEAROTHERMOPHILUS [TaxId:1422]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1utft_
  • Chain 'U':
    Compound: transcription attenuation protein mtrb
    Species: BACILLUS STEAROTHERMOPHILUS [TaxId:1422]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1utfu_
  • Chain 'V':
    Compound: transcription attenuation protein mtrb
    Species: BACILLUS STEAROTHERMOPHILUS [TaxId:1422]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1utfv_
  • Chain 'Z':
    Compound: 5'-r(*up*ap*gp*ap*up)-3'
    Species: synthetic, synthetic
  • Heterogens: TRP, HOH

PDB Chain Sequences:

  • Chain '0':
    No sequence available.

  • Chain '1':
    No sequence available.

  • Chain '2':
    No sequence available.

  • Chain '3':
    No sequence available.

  • Chain '4':
    No sequence available.

  • Chain '5':
    No sequence available.

  • Chain '6':
    No sequence available.

  • Chain '7':
    No sequence available.

  • Chain '8':
    No sequence available.

  • Chain '9':
    No sequence available.

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1utfA (A:)
    mytnsdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkay
    iqtrhgviesegkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1utfA (A:)
    tnsdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkayiq
    trhgvieseg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1utfB (B:)
    mytnsdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkay
    iqtrhgviesegkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1utfB (B:)
    tnsdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkayiq
    trhgviesegk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1utfC (C:)
    mytnsdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkay
    iqtrhgviesegkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1utfC (C:)
    tnsdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkayiq
    trhgvieseg
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1utfD (D:)
    mytnsdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkay
    iqtrhgviesegkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1utfD (D:)
    tnsdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkayiq
    trhgvieseg
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1utfE (E:)
    mytnsdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkay
    iqtrhgviesegkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1utfE (E:)
    tnsdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkayiq
    trhgvieseg
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1utfF (F:)
    mytnsdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkay
    iqtrhgviesegkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1utfF (F:)
    tnsdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkayiq
    trhgvieseg
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1utfG (G:)
    mytnsdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkay
    iqtrhgviesegkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1utfG (G:)
    tnsdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkayiq
    trhgvieseg
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1utfH (H:)
    mytnsdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkay
    iqtrhgviesegkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1utfH (H:)
    tnsdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkayiq
    trhgvieseg
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >1utfI (I:)
    mytnsdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkay
    iqtrhgviesegkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1utfI (I:)
    tnsdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkayiq
    trhgvieseg
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >1utfJ (J:)
    mytnsdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkay
    iqtrhgviesegkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1utfJ (J:)
    tnsdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkayiq
    trhgvieseg
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >1utfK (K:)
    mytnsdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkay
    iqtrhgviesegkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1utfK (K:)
    tnsdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkayiq
    trhgviesegk
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1utfL (L:)
    mytnsdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkay
    iqtrhgviesegkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1utfL (L:)
    tnsdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkayiq
    trhgvieseg
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >1utfM (M:)
    mytnsdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkay
    iqtrhgviesegkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1utfM (M:)
    tnsdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkayiq
    trhgviesegk
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >1utfN (N:)
    mytnsdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkay
    iqtrhgviesegkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1utfN (N:)
    tnsdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkayiq
    trhgvieseg
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >1utfO (O:)
    mytnsdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkay
    iqtrhgviesegkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1utfO (O:)
    tnsdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkayiq
    trhgviesegk
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >1utfP (P:)
    mytnsdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkay
    iqtrhgviesegkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1utfP (P:)
    tnsdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkayiq
    trhgvieseg
    

  • Chain 'Q':
    Sequence, based on SEQRES records: (download)
    >1utfQ (Q:)
    mytnsdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkay
    iqtrhgviesegkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1utfQ (Q:)
    tnsdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkayiq
    trhgvieseg
    

  • Chain 'R':
    Sequence, based on SEQRES records: (download)
    >1utfR (R:)
    mytnsdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkay
    iqtrhgviesegkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1utfR (R:)
    tnsdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkayiq
    trhgvieseg
    

  • Chain 'S':
    Sequence, based on SEQRES records: (download)
    >1utfS (S:)
    mytnsdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkay
    iqtrhgviesegkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1utfS (S:)
    tnsdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkayiq
    trhgvieseg
    

  • Chain 'T':
    Sequence, based on SEQRES records: (download)
    >1utfT (T:)
    mytnsdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkay
    iqtrhgviesegkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1utfT (T:)
    tnsdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkayiq
    trhgvieseg
    

  • Chain 'U':
    Sequence, based on SEQRES records: (download)
    >1utfU (U:)
    mytnsdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkay
    iqtrhgviesegkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1utfU (U:)
    tnsdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkayiq
    trhgvieseg
    

  • Chain 'V':
    Sequence, based on SEQRES records: (download)
    >1utfV (V:)
    mytnsdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkay
    iqtrhgviesegkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1utfV (V:)
    tnsdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkayiq
    trhgvieseg
    

  • Chain 'Z':
    No sequence available.