PDB entry 1ute

View 1ute on RCSB PDB site
Description: pig purple acid phosphatase complexed with phosphate
Class: hydrolase
Keywords: purple acid phosphatase, tartrate resistant acid phosphatase, metalloenzyme, uteroferrin, hydrolase
Deposited on 1999-01-18, released 1999-10-01
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: 0.213
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (II purple acid phosphatase)
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1utea_
  • Heterogens: PO4, FEO, IPA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1uteA (A:)
    taptpilrfvavgdwggvpnapfhtaremanakaiattvktlgadfilslgdnfyftgvh
    dakdkrfqetfedvfsdpslrnvpwhvlagnhdhlgnvsaqiayskiskrwnfpspyyrl
    rfkiprsnvsvaifmldtvtlcgnsddfvsqqperprnlalartqlawikkqlaaakedy
    vlvaghypvwsiaehgpthclvkqllplltthkvtaylcghdhnlqylqdenglgfvlsg
    agnfmdpskkhlrkvpngylrfhfgaenslggfayveitpkemsvtyieasgkslfktkl
    prrarsehqhrra
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uteA (A:)
    ptpilrfvavgdwggvpnapfhtaremanakaiattvktlgadfilslgdnfyftgvhda
    kdkrfqetfedvfsdpslrnvpwhvlagnhdhlgnvsaqiayskiskrwnfpspyyrlrf
    kiprsnvsvaifmldtvtlcgnsddfvsqqperprnlalartqlawikkqlaaakedyvl
    vaghypvwsiaehgpthclvkqllplltthkvtaylcghdhnlqylqdenglgfvlsgag
    nfmdpskkhlrkvpngylrfhfgaenslggfayveitpkemsvtyieasgkslfktklpr
    ra