PDB entry 1utd

View 1utd on RCSB PDB site
Description: The structure of the trp RNA-binding attenuation protein (TRAP) bound to a 63-nucleotide RNA molecule containing GAGUUU repeats
Class: RNA binding protein
Keywords: RNA binding protein, transcription regulation, RNA-binding, trp RNA transcription attenuation, RNA-binding protein,
Deposited on 2003-12-08, released 2004-01-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-08-06, with a file datestamp of 2014-08-01.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.17
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain '0':
    Compound: 5'-r(*gp*up*up*up*gp*ap)-3'
    Species: synthetic, synthetic
  • Chain '1':
    Compound: 5'-r(*gp*up*up*up*gp*ap)-3'
    Species: synthetic, synthetic
  • Chain '2':
    Compound: 5'-r(*gp*up*up*up*gp*ap)-3'
    Species: synthetic, synthetic
  • Chain '3':
    Compound: 5'-r(*gp*up*up*up*gp*ap)-3'
    Species: synthetic, synthetic
  • Chain '4':
    Compound: 5'-r(*gp*up*up*up*gp*ap)-3'
    Species: synthetic, synthetic
  • Chain '5':
    Compound: 5'-r(*gp*up*up*up*gp*ap)-3'
    Species: synthetic, synthetic
  • Chain '6':
    Compound: 5'-r(*gp*up*up*up*gp*ap)-3'
    Species: synthetic, synthetic
  • Chain '7':
    Compound: 5'-r(*gp*up*up*up*gp*ap)-3'
    Species: synthetic, synthetic
  • Chain '8':
    Compound: 5'-r(*gp*up*up*up*gp*ap)-3'
    Species: synthetic, synthetic
  • Chain '9':
    Compound: 5'-r(*gp*up*up*up*gp*ap)-3'
    Species: synthetic, synthetic
  • Chain 'A':
    Compound: transcription attenuation protein mtrb
    Species: BACILLUS STEAROTHERMOPHILUS [TaxId:1422]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1utda_
  • Chain 'B':
    Compound: transcription attenuation protein mtrb
    Species: BACILLUS STEAROTHERMOPHILUS [TaxId:1422]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1utdb_
  • Chain 'C':
    Compound: transcription attenuation protein mtrb
    Species: BACILLUS STEAROTHERMOPHILUS [TaxId:1422]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1utdc_
  • Chain 'D':
    Compound: transcription attenuation protein mtrb
    Species: BACILLUS STEAROTHERMOPHILUS [TaxId:1422]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1utdd_
  • Chain 'E':
    Compound: transcription attenuation protein mtrb
    Species: BACILLUS STEAROTHERMOPHILUS [TaxId:1422]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1utde_
  • Chain 'F':
    Compound: transcription attenuation protein mtrb
    Species: BACILLUS STEAROTHERMOPHILUS [TaxId:1422]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1utdf_
  • Chain 'G':
    Compound: transcription attenuation protein mtrb
    Species: BACILLUS STEAROTHERMOPHILUS [TaxId:1422]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1utdg_
  • Chain 'H':
    Compound: transcription attenuation protein mtrb
    Species: BACILLUS STEAROTHERMOPHILUS [TaxId:1422]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1utdh_
  • Chain 'I':
    Compound: transcription attenuation protein mtrb
    Species: BACILLUS STEAROTHERMOPHILUS [TaxId:1422]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1utdi_
  • Chain 'J':
    Compound: transcription attenuation protein mtrb
    Species: BACILLUS STEAROTHERMOPHILUS [TaxId:1422]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1utdj_
  • Chain 'K':
    Compound: transcription attenuation protein mtrb
    Species: BACILLUS STEAROTHERMOPHILUS [TaxId:1422]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1utdk_
  • Chain 'L':
    Compound: transcription attenuation protein mtrb
    Species: BACILLUS STEAROTHERMOPHILUS [TaxId:1422]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1utdl_
  • Chain 'M':
    Compound: transcription attenuation protein mtrb
    Species: BACILLUS STEAROTHERMOPHILUS [TaxId:1422]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1utdm_
  • Chain 'N':
    Compound: transcription attenuation protein mtrb
    Species: BACILLUS STEAROTHERMOPHILUS [TaxId:1422]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1utdn_
  • Chain 'O':
    Compound: transcription attenuation protein mtrb
    Species: BACILLUS STEAROTHERMOPHILUS [TaxId:1422]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1utdo_
  • Chain 'P':
    Compound: transcription attenuation protein mtrb
    Species: BACILLUS STEAROTHERMOPHILUS [TaxId:1422]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1utdp_
  • Chain 'Q':
    Compound: transcription attenuation protein mtrb
    Species: BACILLUS STEAROTHERMOPHILUS [TaxId:1422]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1utdq_
  • Chain 'R':
    Compound: transcription attenuation protein mtrb
    Species: BACILLUS STEAROTHERMOPHILUS [TaxId:1422]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1utdr_
  • Chain 'S':
    Compound: transcription attenuation protein mtrb
    Species: BACILLUS STEAROTHERMOPHILUS [TaxId:1422]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1utds_
  • Chain 'T':
    Compound: transcription attenuation protein mtrb
    Species: BACILLUS STEAROTHERMOPHILUS [TaxId:1422]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1utdt_
  • Chain 'U':
    Compound: transcription attenuation protein mtrb
    Species: BACILLUS STEAROTHERMOPHILUS [TaxId:1422]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1utdu_
  • Chain 'V':
    Compound: transcription attenuation protein mtrb
    Species: BACILLUS STEAROTHERMOPHILUS [TaxId:1422]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1utdv_
  • Chain 'Z':
    Compound: 5'-r(*gp*up*up*up*gp*ap)-3'
    Species: synthetic, synthetic
  • Heterogens: TRP, HOH

PDB Chain Sequences:

  • Chain '0':
    No sequence available.

  • Chain '1':
    No sequence available.

  • Chain '2':
    No sequence available.

  • Chain '3':
    No sequence available.

  • Chain '4':
    No sequence available.

  • Chain '5':
    No sequence available.

  • Chain '6':
    No sequence available.

  • Chain '7':
    No sequence available.

  • Chain '8':
    No sequence available.

  • Chain '9':
    No sequence available.

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1utdA (A:)
    mytnsdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkay
    iqtrhgviesegkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1utdA (A:)
    tnsdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkayiq
    trhgvieseg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1utdB (B:)
    mytnsdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkay
    iqtrhgviesegkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1utdB (B:)
    tnsdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkayiq
    trhgviesegk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1utdC (C:)
    mytnsdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkay
    iqtrhgviesegkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1utdC (C:)
    tnsdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkayiq
    trhgvieseg
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1utdD (D:)
    mytnsdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkay
    iqtrhgviesegkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1utdD (D:)
    tnsdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkayiq
    trhgviesegk
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1utdE (E:)
    mytnsdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkay
    iqtrhgviesegkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1utdE (E:)
    tnsdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkayiq
    trhgvieseg
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1utdF (F:)
    mytnsdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkay
    iqtrhgviesegkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1utdF (F:)
    tnsdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkayiq
    trhgvieseg
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1utdG (G:)
    mytnsdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkay
    iqtrhgviesegkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1utdG (G:)
    tnsdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkayiq
    trhgvieseg
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1utdH (H:)
    mytnsdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkay
    iqtrhgviesegkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1utdH (H:)
    tnsdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkayiq
    trhgviesegk
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >1utdI (I:)
    mytnsdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkay
    iqtrhgviesegkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1utdI (I:)
    tnsdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkayiq
    trhgvieseg
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >1utdJ (J:)
    mytnsdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkay
    iqtrhgviesegkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1utdJ (J:)
    tnsdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkayiq
    trhgviesegk
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >1utdK (K:)
    mytnsdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkay
    iqtrhgviesegkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1utdK (K:)
    tnsdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkayiq
    trhgvieseg
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1utdL (L:)
    mytnsdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkay
    iqtrhgviesegkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1utdL (L:)
    tnsdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkayiq
    trhgviesegk
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >1utdM (M:)
    mytnsdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkay
    iqtrhgviesegkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1utdM (M:)
    tnsdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkayiq
    trhgvieseg
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >1utdN (N:)
    mytnsdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkay
    iqtrhgviesegkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1utdN (N:)
    tnsdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkayiq
    trhgvieseg
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >1utdO (O:)
    mytnsdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkay
    iqtrhgviesegkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1utdO (O:)
    tnsdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkayiq
    trhgviesegk
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >1utdP (P:)
    mytnsdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkay
    iqtrhgviesegkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1utdP (P:)
    tnsdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkayiq
    trhgvieseg
    

  • Chain 'Q':
    Sequence, based on SEQRES records: (download)
    >1utdQ (Q:)
    mytnsdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkay
    iqtrhgviesegkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1utdQ (Q:)
    tnsdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkayiq
    trhgviesegk
    

  • Chain 'R':
    Sequence, based on SEQRES records: (download)
    >1utdR (R:)
    mytnsdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkay
    iqtrhgviesegkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1utdR (R:)
    tnsdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkayiq
    trhgviesegk
    

  • Chain 'S':
    Sequence, based on SEQRES records: (download)
    >1utdS (S:)
    mytnsdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkay
    iqtrhgviesegkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1utdS (S:)
    tnsdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkayiq
    trhgvieseg
    

  • Chain 'T':
    Sequence, based on SEQRES records: (download)
    >1utdT (T:)
    mytnsdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkay
    iqtrhgviesegkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1utdT (T:)
    tnsdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkayiq
    trhgvieseg
    

  • Chain 'U':
    Sequence, based on SEQRES records: (download)
    >1utdU (U:)
    mytnsdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkay
    iqtrhgviesegkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1utdU (U:)
    tnsdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkayiq
    trhgvieseg
    

  • Chain 'V':
    Sequence, based on SEQRES records: (download)
    >1utdV (V:)
    mytnsdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkay
    iqtrhgviesegkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1utdV (V:)
    tnsdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkayiq
    trhgvieseg
    

  • Chain 'Z':
    No sequence available.