PDB entry 1utc

View 1utc on RCSB PDB site
Description: clathrin terminal domain complexed with tlpwdlwtt
Class: endocytosis
Keywords: endocytosis, clathrin, cytoskeleton
Deposited on 2003-12-08, released 2004-02-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.197
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: clathrin heavy chain
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1utca1, d1utca2
  • Chain 'B':
    Compound: clathrin heavy chain
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1utcb1, d1utcb2
  • Chain 'P':
    Compound: amphiphysin
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'Q':
    Compound: amphiphysin
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1utcA (A:)
    maqilpirfqehlqlqnlginpanigfstltmesdkficirekvgeqaqvviidmndpsn
    pirrpisadsaimnpaskvialkagktlqifniemkskmkahtmtddvtfwkwislntva
    lvtdnavyhwsmegesqpvkmfdrhsslagcqiinyrtdakqkwllltgisaqqnrvvga
    mqlysvdrkvsqpieghaasfaqfkmegnaeestlfcfavrgqaggklhiievgtpptgn
    qpfpkkavdvffppeaqndfpvamqisekhdvvflitkygyihlydletgtciymnrisg
    etifvtapheatagiigvnrkgqvlsvcveeeniipyitnvlqnpdlalrmavrnnlaga
    eel
    

    Sequence, based on observed residues (ATOM records): (download)
    >1utcA (A:)
    ilpirfqehlqlqnlginpanigfstltmesdkficirekvgeqaqvviidmndpsnpir
    rpisadsaimnpaskvialkagktlqifniemkskmkahtmtddvtfwkwislntvalvt
    dnavyhwsmegesqpvkmfdrhsslagcqiinyrtdakqkwllltgisaqqnrvvgamql
    ysvdrkvsqpieghaasfaqfkmegnaeestlfcfavrgqaggklhiievgtpptgnqpf
    pkkavdvffppeaqndfpvamqisekhdvvflitkygyihlydletgtciymnrisgeti
    fvtapheatagiigvnrkgqvlsvcveeeniipyitnvlqnpdlalrmavrn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1utcB (B:)
    maqilpirfqehlqlqnlginpanigfstltmesdkficirekvgeqaqvviidmndpsn
    pirrpisadsaimnpaskvialkagktlqifniemkskmkahtmtddvtfwkwislntva
    lvtdnavyhwsmegesqpvkmfdrhsslagcqiinyrtdakqkwllltgisaqqnrvvga
    mqlysvdrkvsqpieghaasfaqfkmegnaeestlfcfavrgqaggklhiievgtpptgn
    qpfpkkavdvffppeaqndfpvamqisekhdvvflitkygyihlydletgtciymnrisg
    etifvtapheatagiigvnrkgqvlsvcveeeniipyitnvlqnpdlalrmavrnnlaga
    eel
    

    Sequence, based on observed residues (ATOM records): (download)
    >1utcB (B:)
    qilpirfqehlqlqnlginpanigfstltmesdkficirekvgeqaqvviidmndpsnpi
    rrpisadsaimnpaskvialkagktlqifniemkskmkahtmtddvtfwkwislntvalv
    tdnavyhwsmegesqpvkmfdrhsslagcqiinyrtdakqkwllltgisaqqnrvvgamq
    lysvdrkvsqpieghaasfaqfkmegnaeestlfcfavrgqaggklhiievgtpptgnqp
    fpkkavdvffppeaqndfpvamqisekhdvvflitkygyihlydletgtciymnrisget
    ifvtapheatagiigvnrkgqvlsvcveeeniipyitnvlqnpdlalrmavrn
    

  • Chain 'P':
    No sequence available.

  • Chain 'Q':
    No sequence available.